KEGG   Podospora anserina: PODANSg1348Help
Entry
PODANSg1348       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pan  Podospora anserina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg1348
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PODANSg1348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 467 aa AA seqDB search
LLPSLSQLGITKIWIPPACKAADAKNGNGYDIYDLWDLGEFEQKGSTPTKWGSKAQLEEL
CRVAEGRGVKVLFDAVLNHKTGADYKERVKAKKVDPLDRNRELDGGEVREIESWTGFTFP
GRGGRYSGREWDRRHFTGVDWDDLTREKGVWKLGGKEWCVDVDEEVGNYDFLMFADVDHR
HPDVQQDAFDWVKWLPTQLKIGGLRLDAIKHYSFQFQKRLLRHIDDNVEKGKDWFIVGEY
WREDSEFLAKYIEYMDHRISLFDVPLCSNLSKISMAGERGDLRDLFKDALCLWKPNNVVT
PVAPWFLPHAYTLILLRANTGVPCVFWSDLYGSFASGPSSFIPPMSGNPTLLARLILIRK
LYAYGTQHDLFSHQHCVGFTREGHSAHGGGAGLAAVMGNQWGLSKLRMYVGKHHSGEKWI
DFLRLCPGEVMIDDEGWGEFPVSGNRGCSVWVSETAEGKDEVINLKL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ctcctcccctccctttcccagctcggcataaccaaaatctggattccccccgcctgcaaa
gcagccgacgcgaaaaacggaaacgggtatgacatctacgacctgtgggacctaggcgag
tttgaacagaagggctccaccccgacaaaatgggggtcaaaagcgcaactggaggagctt
tgtagagtggcggaggggaggggggtgaaagttttgtttgatgccgtgctgaatcacaaa
actggagcggactacaaagagagggtcaaggcgaagaaggttgaccccttggaccggaat
agggaactagatgggggggaggtgagggagattgagagttggacggggtttacgttcccg
gggcggggggggaggtacagtggtcgagaatgggacaggagacattttacgggggtggat
tgggatgacttgactagggaaaagggggtttggaagctgggggggaaggagtggtgtgtg
gatgtggatgaggaggtggggaattatgactttttaatgtttgccgatgttgaccaccga
catccggacgtgcagcaggatgcttttgattgggtaaagtggctgccgacgcagctcaag
attggagggttgaggttggatgcgattaagcattatagcttccagtttcagaagagactg
ctgaggcacattgacgataatgttgagaagggaaaggactggtttattgttggggagtac
tggagagaggactctgagttcttggccaagtatattgagtatatggaccaccggatttcg
ctgttcgatgtgccgttgtgctctaatttgagcaagatatctatggctggggagagaggc
gacctaagggacctgttcaaggatgctttgtgtttgtggaagcctaataacgttgtgact
cccgtagccccctggtttctaccccacgcctataccctcatcctcctccgcgccaacacc
ggcgtgccctgcgtattttggtctgacctctacggctccttcgcctccggtccctcttct
ttcatccctcccatgtccgggaatcccaccctcctcgctcgcctcatcctcatccgcaag
ctctacgcctatggcacccagcatgatctcttttcccaccaacactgtgtcggtttcact
cgtgagggtcactccgcccacggtgggggtgctgggctagcggcggtgatgggtaatcag
tggggcctgtcaaagctgagaatgtacgttgggaaacaccacagtggggagaaatggatc
gatttcttgagactgtgtcccggggaggtcatgattgatgatgagggttggggggagttt
cctgtgtcgggcaacaggggttgctcggtttgggtcagtgagacagcagaagggaaggat
gaggttatcaacctcaaattgtaa

DBGET integrated database retrieval system