KEGG   Podospora anserina: PODANSg1402Help
Entry
PODANSg1402       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
pan  Podospora anserina
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pan00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PODANSg1402
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PODANSg1402
Peptidases [BR:pan01002]
 Metallo Peptidases
  Family M67
   PODANSg1402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 504 aa AA seqDB search
MASTPNMDSDRPLSVRELTDLGLQYDFLPQLPLNRWYRAAEVVYREATHYLRDGNTPQAF
MMFQRYCDLVMYKLRTHPDINLPESRPQYKTLSKRIPAIIELMESMRVEIDEYYSRWEAR
MRAQRRSQPPAKSTIRLVDPALSWNHASPGSILDARSNKDLAIEMANKERLRRRNATKMA
PSRSSRIISEDELQRRNMEAVRNQLDRSYRTSDTNDRLQSTNYSYPSIKQSAPLSYESAP
RRPSPPPARPMPPRPPKQLPEPSRPPSVSPPSRPRKELDTEAFVTTRSQSPVRPPKEALE
PAPEPKRRYTFKPEKYLENGDPIRSIFLPESLRRRFLAIAEPNTRRGLEMCGLLCGANIN
NALFITHLVIPDQDCTENTCDTRNEADIWEFCDKEELIQIGWIHTHPTQTCFLSSRDMHT
QASYQAMLSESIAIVCAPRYEPSWGVFRLTNPPGLPEMLKCRKTDPFHPHDVPGDQLYVN
ALQPAGHVIEADLNVDVCDLRGKT
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacgccaaacatggacagcgaccggccattatcggttagggagctcacagac
ctgggtttgcaatatgacttcctgccccagctccccctcaaccggtggtaccgggcggct
gaagttgtctaccgggaggctacccactacctccgcgatgggaatactccccaggccttc
atgatgttccaacgatactgcgatctcgtcatgtataagctcagaacacatcccgacatc
aaccttcccgaatcccggcctcaatacaagaccctgtccaaacgtatccctgccatcata
gagctgatggaatcgatgcgggttgagattgatgaatactacagcagatgggaggcacga
atgagggctcaacgccgttcacaacctccggcaaagagcacaatcagactggtggatcca
gccctgtcttggaaccacgcttcgccggggagcatattagatgccaggtccaataaggat
ctcgccatcgaaatggccaacaaggaaagactccggaggagaaatgcgactaagatggcg
ccctctcggtcgtctcgaataatttcagaagatgagctgcagcgcaggaatatggaggca
gttcgaaatcagttggaccgatcgtataggacatcagacaccaatgaccgcttacagtcg
accaactattcttacccttcgatcaagcagtcggctcctctttcgtacgaatccgctcct
cgacgcccgagtcccccccctgctcggcccatgccaccacgacctcccaagcaactgccc
gagccatcccgtcctccctccgtttcacccccttcacggcccaggaaggaactggacact
gaagcatttgtcacaacgaggtcacaatctcctgttagaccgcctaaagaagccctcgag
cccgcacctgagcccaagagaaggtacacatttaaacctgaaaagtatttagagaacggt
gacccgatccgttcaatctttttgccggagtcgcttcggagacggttcctcgctattgcc
gagccaaataccagaagagggctcgaaatgtgcggcctcctctgcggcgccaacatcaac
aatgccctttttatcacacaccttgtgatacccgatcaggattgtaccgagaacacttgt
gataccagaaacgaagccgacatttgggagttttgtgacaaggaggagttgatacagatt
ggttggatccacacgcacccgacgcaaacatgcttcctcagctcccgcgacatgcatacg
caggctagttaccaagctatgttgtctgagagtattgccatcgtttgcgccccacgatac
gaaccttcctggggagtctttcggttgaccaacccaccgggcctaccggagatgctgaag
tgccgaaagacggatccatttcatccgcacgatgtcccgggcgatcaactttacgtgaac
gcccttcagcctgccgggcatgtcatcgaagcggacctcaatgtcgacgtttgcgatctt
cggggaaagacatag

  All links  
No link information was found.   
DBGET integrated database retrieval system