KEGG   Podospora anserina: PODANSg1551Help
Entry
PODANSg1551       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pan  Podospora anserina
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PODANSg1551
  Lipid metabolism
   00062 Fatty acid elongation
    PODANSg1551
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     PODANSg1551
Lipid biosynthesis proteins [BR:pan01004]
 Fatty acid synthase
  Component type
   PODANSg1551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 358 aa AA seqDB search
MAIKNHLRLLFTAGSLLATTFASPVSRFEDDDDDDTPLPVVIWHGLGDAYNADGMRQVAD
LAESVNPGTLVYPIRIEDAGNRDRYDSFVGNVTEQLAKVCVDIAAHPILSTAPAIDAVGF
SQGGQFLRGYVERCNNPPVRSLITFGSQHNGITRFRDCETNDWICRFAMAVLGTNPWSPT
VQGKLVPAQYFRDPEQYEKYLEHSNFLADINNERSIKNETYKKNIAKLENFVMYMFDEDT
TVVPKETSWFEDVNGTEITPLRARKLYSEDWLGLRELDRKGGLKFRTAPGDHMQLSDELL
TEAFGDFFGPLNRHKGRSDPRPASHVGDEEFDMGSGGRSEGRPASRGGEVESDMGNDL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcgataaaaaaccacttgcggctgttgttcacagccgggtcgctgcttgcgacgacg
tttgccagccccgtcagtcgctttgaagatgacgacgatgatgacaccccgctgccagtg
gtgatctggcatggtctcggagacgcctacaacgccgatggcatgcgtcaggtagccgac
ctcgccgagtcagtcaaccccggcacactcgtctaccccattcgcatcgaagacgccggc
aaccgcgaccgctacgactccttcgtcggcaacgtcaccgagcaactagccaaagtgtgc
gtcgacatcgccgcccacccgatcctctccaccgccccagccatcgacgccgtgggcttc
tcccaaggcggccagttcctccgcggctacgtcgagcgctgtaacaatccccccgtccga
agtttgatcaccttcggctcccagcacaacggcatcacccgctttagagactgcgagacg
aacgactggatctgccggttcgccatggccgtcctagggaccaatccctggtcccccacg
gtccagggcaagctggtccccgcgcagtatttccgcgatcctgaacaatacgagaagtac
ctcgagcattccaacttccttgcggatatcaacaacgagcggtcgatcaagaacgagacg
tacaagaagaacattgcgaagctggagaactttgtcatgtacatgtttgacgaggacacg
acggtggtgcccaaggagacgtcgtggtttgaggatgtgaatggcaccgagattacacct
ttgcgtgcgaggaagctgtattcggaggattggttgggattgagggagctggatcgcaag
ggcgggctgaagttcaggactgcgcctggggatcacatgcagttgtcggatgagttgttg
acagaggcatttggggatttctttgggcctttgaataggcacaaggggaggtcggatccc
cgtcctgcttcgcacgttggagacgaagagtttgacatgggcagtggcgggaggtcagag
ggtcgtcctgcttcgagaggcggagaagttgagtctgatatgggcaacgacttgtaa

DBGET integrated database retrieval system