KEGG   Podospora anserina: PODANSg157Help
Entry
PODANSg157        CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pan  Podospora anserina
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pan00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 446 aa AA seqDB search
MYSFCPDLLQTTYPDVKPPTPLTQPARCRPPRSGIHRNIRVWDPGSMKKNSPSRGPESAN
PDSTACAIGLPLYHLSPPSTKQANEFPHFSFQRRHISAHSESSIVYAHSVMVQFASPSRS
QSPSGASSAGEPRRTKKSKGKDGSSSKKKRPSAADDQDRDDTKASGNGTSVRQNAERRSS
MSKPARDFRDQPEPTPKKKKRKTSTSSAAVPEPAIAPTPEEAGETSTRSPSPLIDFDGLS
RPSRGTRERLDESPEQKELRMEKMKGAVRTLLECIGEDPDREGLLATPERYAKAMLFFTK
GYQENVRDIVNGAIFQEGHNEMVIVKDIEVFSMCEHHLVPFNGKMHIGYIPSNAVIGISK
LPRIAELFARRLQIQERLTKEVAHAIMEVLKPQGVAVVMESSHLCMVMRGVEKTTTSTIT
SCVLGCFERKEKTRNEFLSLIGVNRR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtattcattctgccccgatttgctgcagactacataccctgacgtcaaacctcccact
cctctcacccagcctgctaggtgtcgtccgccacgttcgggtatccacagaaatatcaga
gtttgggatccagggtccatgaaaaaaaactcgccgagcaggggaccggagtctgccaat
cctgactcgaccgcttgcgccatcggcctgccattgtatcatctgtctcccccttctacc
aaacaagcaaacgagttcccccatttttcctttcaacggcgacacatttccgcccactcc
gaatcatccatcgtgtatgcgcattccgtcatggttcagttcgcatcgccctctcgcagc
cagagcccctcgggtgcctcgtccgctggcgaaccccggcgcaccaaaaagtccaagggc
aaagatggcagcagcagcaagaagaagcgccccagcgccgccgacgaccaagatagagat
gacaccaaggccagcggcaacggcaccagcgtccgtcagaacgccgagagacgttccagc
atgagcaagccggcccgcgacttccgggaccagcccgaacccacgccaaagaagaagaag
agaaagacatcgacctcgtcggcggccgtccctgagcccgccatcgctccgacaccggaa
gaggctggcgagacgtcgacccgctcgccgagccccctcatcgactttgacggcctctcc
cgccccagccgcggcactcgggagaggttagacgagtcccccgagcagaaggagctgcgc
atggagaagatgaagggcgccgtccgcaccctcctcgagtgcatcggcgaggatcccgac
agggagggtctcctggccacgcccgagcgctacgccaaagccatgctcttcttcacaaag
ggctaccaggaaaacgtgcgagacattgtcaacggcgccatcttccaggaaggccacaac
gagatggtcatcgtcaaggacattgaggtgttcagcatgtgcgagcaccacctggtgccc
ttcaacggcaagatgcacattggctacatcccgtccaacgccgtcattggcatctcgaag
ctgccgcgcatcgccgagctgtttgctcgccgcctgcagatccaggagcgcctgaccaag
gaggtggcgcacgccatcatggaggtgctcaaaccccagggtgtggccgtggtgatggag
tcgagccatctgtgcatggtcatgaggggggtggaaaagacgacgacgagcaccatcacc
agctgcgtcctggggtgctttgaaaggaaggagaagacgagaaacgagtttctgagcctg
attggcgtcaaccgccggtaa

DBGET integrated database retrieval system