KEGG   Podospora anserina: PODANSg1582Help
Entry
PODANSg1582       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     PODANSg1582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 402 aa AA seqDB search
MANSAPKVAEAERFETDRAISLKAKDIANLIKHSKHFIVFTGAGVSTSAGIPDFRGPDGV
WTLRKQKRDAPSKATSTLQAIPTPTHMALVKLQNRGLLKYLVSQNCDGLHRKSGIAPEMI
SELHGNSNREYCRDCGKEYIRDFRAVAPYTKTVTDHRTGRKCSMPGCNGVLLDTIINFGE
CLFEQPLKLAREHGKKADFCLVLGSSLTVPPACTIPEIAGKSKRGKLGICNLQSTPLDHL
VDGESMRVFARTDDLMIAVMGHLCLEIPQFVLRRQLTVKVVMGERDRNQVILQGVDVDGT
PSTFLKSVRLEGSRRPAVTEPFTLSFRMDGQEELRLKLELEFMGNYLEPNVEIVHSTQCS
ERLYLLEYSPYTREWQVVAKDYCELSEVPTFLDFTEIGANGP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattcagctcccaaagtggccgaagccgaacgattcgaaacggaccgggcgatt
tcgctcaaggccaaagacattgccaacctgatcaagcacagcaagcattttattgtcttc
accggtgcgggcgtctcgacttctgcagggattcccgactttcgtggtccagatggcgtg
tggactttgcgaaagcagaaacgcgacgcgccgtccaaggccactagcacgctgcaagcc
atccccactccgacacacatggcacttgtcaagcttcaaaacaggggacttctcaagtac
cttgtgagccagaactgtgatgggctgcatcgtaaaagtggtatcgcgcctgagatgatc
tcggagctgcatgggaacagtaatagggagtactgtcgtgactgtggaaaggaatacatt
cgagactttcgggctgttgcaccttacaccaagacagtcacagaccaccgcactggccgc
aagtgcagcatgccgggctgcaatggtgttcttcttgacaccatcatcaactttggcgag
tgtttatttgagcaacctttgaagctggcgagagaacatggcaagaaggccgatttctgt
ctagtcctcggatcaagcttgacggtgcctcccgcttgtaccatccctgagatcgcaggc
aagagcaaaagggggaagctgggaatctgcaacctgcaaagcacaccgctggatcatctt
gtggacggggaaagcatgagggtttttgcgaggaccgatgatctcatgattgctgtaatg
ggtcatctatgtctagaaatcccccagttcgtgctaaggaggcaactgacagtgaaggtg
gtaatgggggagagggatagaaaccaagtcatcctgcaaggagttgacgtggacggaacc
ccaagcacttttctcaaaagcgtcaggttggagggcagcagacgacccgcagtgacagag
ccctttacgctgagtttccgcatggatggacaggaagagcttcgattgaaactcgagctg
gaattcatgggaaattacctggagcctaacgttgagattgtgcactcaacccaatgctct
gagcgtctttacttgctagagtacagtccgtatacaagggagtggcaggttgtggcaaaa
gattactgtgagttgtctgaagtccctaccttccttgacttcacggagattggtgctaac
gggccttga

DBGET integrated database retrieval system