KEGG   Podospora anserina: PODANSg1793Help
Entry
PODANSg1793       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PODANSg1793
Peptidases [BR:pan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PODANSg1793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1115 aa AA seqDB search
MDSLNTGGRLARRLIEDWYRGALQHANRSEPRLQSCYHLRGARPGPVGPNDDHDLIMIPS
QTHGHQMACLCKHCRYHFVFTWAEPEFSSPGHPQHHFVVAPGDDESFGEEKGKQLLVTWP
SRDKKLGPLMRKTSYRCSFCGFSIRLDVSAPRLASRWIDIVTDESRAKRNLKRAMDEDPG
RFKDMTQEKLAKLESSALMTLNMYITNIMSNDSTSAEKKISERNKTFMVQFGPECEELFL
YLGFTKRQEAEDTFYISPQVPPENGGRTFLYSERSFFENVKSEIQSVIDQKRPELVHQHS
PARIKLQTVLGVDDAQTRTVHWKVSESDLHYFYLLGASSKTTEPMLIWAYERQAAVDRDH
ERYYREAFNCLAYHGDEEMQMYAVHLDQKALPRPEKSEYDKDWEWFGFWRAQGRTLTKDR
IIERYKHYRETRPEAGHLHRLHLAKIARDLGQRDLVYIAVVDMDEAEANGVLDSTAQTAP
DTIAYAALESVNNNEKDAAVVVTAMNLIGARMARQRRGDKDFDEALGDFETISGQLESLV
SGETQNQDFCDPVSNGQEMEVGAGDLTLPVGLDNIRNTCYLNSILQYLYTVDVIRDLLRT
LDLDTPEASTDRVGEILSGSVSGVEEGQKKEAFLGHEFARELKTLFHEMEETRYTHVKPR
QRLANAAMARADKGGSTAESKATGPKAANSAVPELKITTSTDADAKMVNGEETSELEHVE
TASVSSSQTLVGETPAAASTGPGKKMEKAGPLEALVKELDQDEVKGTAQQDVDEAMGNIL
EHLQAALKLARARRNAGEDGSEEIPDPIDDHFYSNFRIYNRTRGNDDVQGWTTHEDRNRM
IMAPLHETKAVQEDLYQAIGRGMDVQLNEETNKMTYSVFKRPADILHFLFPRSRALDLKN
ENPVELNDPLYLDLFMDVVPGDERYGKRTRLWALNKRLEELNTKPRAFEPGSAKILSEED
IDRLVTENGLIDADGDYELVDADERTALATKEVQGGWVAVSPEKLKQFEERQRADDSAEL
LKEKQGLVVGEVEYRLHAVFCHTGTPRSGHYWVWIKDFERGAWHKYNDELVTVHSEEDFR
KQAGTAAEPCWAAYVRADKVAGLVSTPLRKRVRGG
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggactccctcaacacaggtggccgccttgccagaaggctcatcgaggactggtaccgg
ggtgctctgcagcatgccaaccggtctgaaccccgactccagtcttgctaccatctgcga
ggagcccgccccggcccagtcggtcccaacgacgaccacgaccttatcatgattccctcg
cagacacacggccaccagatggcttgtctatgcaagcactgccggtaccacttcgtcttc
acctgggccgagccagaatttagtagccctggccatcctcaacatcactttgtcgtggca
ccgggggatgacgaatccttcggcgaggagaaggggaagcaactcctcgttacttggcct
agtagggacaagaaactgggccctttgatgcgcaagaccagctaccggtgcagcttttgc
ggcttcagcatccggctcgatgtgtcagcaccacgcctggccagcaggtggatcgacatc
gtcacggatgagtcgcgcgccaagagaaacctcaagagggccatggacgaggacccgggc
agatttaaggacatgacgcaagagaagctcgctaaactcgagtccagcgccctcatgaca
ctgaacatgtacattacaaacatcatgtctaatgattccaccagtgccgagaagaagata
tcggagcgcaacaagacgttcatggtgcaattcggtccagaatgcgaggagctcttcctc
taccttggcttcaccaagaggcaagaggccgaagacacattttacatctccccacaggtc
ccaccggagaacggcggcaggacattcctgtactcggagagatctttctttgagaacgtc
aagagcgagatacagagtgtgatcgaccagaagagacctgagcttgttcatcagcattcg
cctgctcgcataaaactgcagacggtactcggagttgacgatgcccagacgcggaccgtg
cactggaaagtgtcggaatccgatctacactacttctatttactgggggcttcttccaag
acaaccgaacccatgttgatttgggcatatgagcggcaagccgccgtggaccgggatcac
gagcgctactacagggaggctttcaattgcttggcctaccacggggacgaggaaatgcag
atgtacgccgtccacttagatcaaaaagccttgcctcgccccgagaagagtgaatatgac
aaggactgggaatggttcggcttttggagggcacagggtcgaactctgaccaaggaccgg
atcatcgagcggtacaagcattacagagaaaccaggcccgaagcaggacatttgcacagg
ctgcacttggccaaaattgctcgggatttaggccaaagggatttggtctacattgccgtg
gtcgacatggacgaggccgaggccaatggcgtgctcgactcaacggcccaaacagcacct
gataccatagcctatgccgccctggaaagtgtgaacaacaatgaaaaggacgcggcggtt
gttgtgacggcaatgaatctcattggagcgagaatggccagacagcgtagaggtgacaag
gattttgacgaggccttgggcgacttcgagaccatcagcgggcagctggagagcctcgtg
agcggcgaaacccagaaccaggacttttgcgatcctgtcagtaatggacaagagatggag
gtcggggccggagacctgacgttgcccgtcgggcttgacaacattcgcaacacttgctac
ctgaacagcattctgcagtatctctacacagtcgatgtcatcagggacctgttgcggacc
ttggacctagacacgcccgaggccagtacagacagggtgggcgagatcctgagtggaagt
gtgagcggggtggaagaaggccaaaaaaaggaagctttcctcggccatgaattcgcgcgc
gagctcaagactttgttccacgagatggaagagactcgatatactcacgtcaaaccacgc
cagcggcttgccaacgccgccatggcccgagctgataagggaggctctactgctgagtcc
aaggccactggccccaaggctgccaactctgcggttcccgagctcaagatcacgacatct
acagacgctgatgccaagatggtgaatggtgaggagacctccgaactcgagcacgtcgag
acggccagtgtatctagttcacagacgctggtgggagagacgccagctgctgcgtcaacg
ggaccggggaagaagatggagaaggcggggcccctggaagctttggtaaaggaacttgac
caagacgaggtcaagggcactgcgcaacaggatgtcgacgaggccatgggaaatatactg
gaacaccttcaagcagccctcaagctagcccgtgcgcgccgcaatgccggggaggacgga
agcgaggaaatacccgatcccatcgacgatcacttttacagcaactttaggatctataac
cggacgcgcgggaacgacgacgtacagggctggaccacacatgaagaccgcaaccgcatg
atcatggcaccgcttcatgagacaaaggcggtccaggaggatctgtaccaggccattggg
cgcggcatggatgtccagctgaatgaagagacaaacaagatgacgtattcggtcttcaaa
aggcctgctgatattctgcactttctattccccaggagtcgtgcgctcgacttgaagaac
gagaatccagtggagctgaacgatccgttgtatttggatctcttcatggatgttgtccca
ggggacgagcggtacgggaagcggacgaggctgtgggctctcaacaagcggttggaggag
ctgaataccaagccacgggcgttcgagccgggttcggccaagattttgtcggaggaggat
attgacaggcttgtgactgagaatggtcttattgatgctgatggggattatgagctcgtt
gatgccgacgagaggactgctcttgccaccaaggaggttcaaggggggtgggttgcggtt
tcccccgagaagctgaagcaattcgaggagcgccagcgggctgatgattcggcagagctt
ctcaaggagaaacaggggcttgtggtcggggaggttgaatacaggcttcacgcggtgttt
tgccacactggaaccccccgatccggccactattgggtgtggatcaaggattttgagcgg
ggtgcgtggcacaaatacaatgacgaattggtgacggtgcacagcgaggaggatttcagg
aagcaggcggggactgcggctgagccttgctgggcggcctatgtacgtgctgacaaggtg
gcgggcttggtgagcacgccgctccggaagagggtacggggtgggtga

DBGET integrated database retrieval system