KEGG   Podospora anserina: PODANSg2017Help
Entry
PODANSg2017       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pan  Podospora anserina
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PODANSg2017
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PODANSg2017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 752 aa AA seqDB search
MSAPSPAPSPAPSPAPSAQPLRSALKNDNDAVQIAEPESSPHDEASVKKQFPAGVGRRLS
GRPGLSATPSRSSTLSQTPSIDVAGETELTASPALIEEPQNSGVASYHRHRIDRVSEKLV
AQVAEWLHREKAKKESRKSRKHSSRRKSPPETPEAGRPRADSLESDSSEVSLDRLQRIID
DSMSALGLGSVPHLGPRLSKKHRKRSSRSLRGAASSDTEFFDGDVVVPSCDAALDNSKTM
SYTGGKAADDNASISSRREDKEKQAWTVFKNEIIRLAHTLRLKGWRRVPLDSGEQISVER
LSGALTNAVYVVSPPPESALLPAEGKKTPGKVLLRIYGPQVEHLIDRENELSVLRRLARK
KIGPRLLGTFLNGRFEQYLNAAALTSQSMREPDTSRQIAKRMRELHDGVELLEEEKDLGP
SVWRNWDKWLAQVEKTVLFLDKQYNDGPNDLSRGPSDSWKKKGYVCGVEWPAFKELVRKY
RQFLDGQYGNPKKIREKLVFAHNDTQYGNILRVRPDDQKSPLLQPANEHKQLVVIDFEYA
GANIPGLEFANHFSEWTYDYHDARYPHVCDTAKYPNVDQQRRFIRAYVDHRPRFPYIDSA
KSTPATTPTGTGPGTSIHTAGSTTSIADFMLDARVPAGGWKEEERKREAATEKRVKELME
ETKLWRTANSAQWVAWGLVQAKIPGLKVSSDGEAEDVTPTEEETEEDADAFDYLGYTQSR
AYFFLGDCVQLGLIKLEDLPEETRGRVKIVEV
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccctctccagcaccctctccagcaccctctccagcaccctcggctcagccg
ctgcgttcggctctgaagaacgacaatgatgccgttcagattgctgaacctgagtcgtcg
cctcacgatgaggcctcagtcaagaagcagtttcctgcaggcgttggcaggaggctgagt
ggacgccctggtctgtctgccacgccgtctaggtcctcgactctcagccagactcccagc
atcgatgttgccggcgaaaccgagctcactgcttctccggcactcattgaagaacctcaa
aacagtggcgtcgcctcctaccaccgccatagaattgatcgcgtgagtgagaagttggta
gctcaggtggctgaatggctccaccgagagaaagccaagaaggagtctagaaagagtcgg
aagcattcttcgcgccgcaagtcacctccagagacgcctgaagccggtcgtcctcgtgcc
gattctctcgagtctgattcgagtgaagtgtctcttgatcgacttcagaggattatcgac
gacagcatgtcggctttgggactggggtctgttcctcacctaggacctcgtctaagcaag
aagcaccggaagaggtctagtaggagcctcagaggtgcggcatcatcggacacggaattt
ttcgatggtgatgttgtggttcccagctgtgatgcggccctcgacaactccaagaccatg
agctacactggaggcaaggcggccgacgacaacgcttctatctctagccgcagggaggat
aaagagaagcaagcttggactgtgttcaagaatgaaatcattcgtttggcacacacgctg
aggctcaaagggtggaggagggtgccccttgacagcggagagcagatctcagttgaacgt
ctcagcggcgcattgacaaacgctgtgtatgtggtctcgccgccccctgaatcggcactg
cttcccgccgagggcaagaagacgccgggcaaggtgctgctaagaatctatggtccccag
gtggagcacctcatcgaccgtgaaaacgagctgagcgtgcttagaaggctggccagaaag
aagattggccctcgcctgcttggcacttttttaaacggtcggtttgagcaatacctcaac
gctgctgcgctcacttcgcaaagcatgcgggagccggatacctccagacagattgctaag
cgcatgagggagcttcatgacggcgtggagctgttggaggaagagaaggaccttggcccc
agtgtttggagaaactgggacaagtggcttgcccaagtcgagaagactgttttgttcctt
gacaagcaatacaatgacgggccaaacgacctgtctcgtggtcctagcgacagctggaag
aagaagggttatgtctgcggagtggaatggccggccttcaaggagctggtccgaaagtat
cgccagtttcttgatggccagtatggcaacccgaagaagatcagagagaagcttgtcttt
gcacacaacgacactcaatacggcaatattctccgcgtccgtccggacgatcagaaatca
ccccttcttcagcccgccaacgagcacaagcaattggttgttattgattttgagtatgcc
ggtgccaacattccaggacttgagtttgccaaccatttctccgaatggacatacgactat
catgacgcgcggtaccctcatgtttgtgacaccgccaagtatcccaacgttgaccagcag
cgccggtttatcagggcctatgtcgatcataggcctaggttcccgtatattgactctgcc
aaaagcacgcccgccacgacacccacagggaccggaccaggaacttctattcacacggcg
ggatctacaacctctattgctgactttatgctggatgcccgcgtcccagccggtgggtgg
aaggaggaggagagaaagagggaagcggcaacggagaagcgagtcaaggagctgatggag
gagaccaaactctggcgcacagccaacagcgcccagtgggttgcgtggggtcttgtccag
gctaagattcctggtttgaaggtttcctcggatggcgaggcggaggatgtgactccaacc
gaggaggagactgaagaggatgccgatgcgtttgattatcttggatatacacagtcgaga
gcctactttttcctgggtgattgtgttcaacttggtttgatcaagttggaggatcttccc
gaggagactaggggacgggtgaagattgttgaggtttga

DBGET integrated database retrieval system