KEGG   Podospora anserina: PODANSg2161Help
Entry
PODANSg2161       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 238 aa AA seqDB search
MAWRSSGTSNSELVENLWRNEMITHPEVKSAFLKVDRAHYAPRSPYEDCPQPIGHHATIS
APHMHASAVEHLLQFIMPGEERPAPRVLDIGSGSGYLTHVLAELVGERGRVVGVEHIEPL
KELGERNMKKSREGRELIEGGRVRFRVGDGRKGWRDEEEQGRKSWDAIHVGAAAVKVHEE
LLEQLASPGRMFIPVDDEDDPQGWGQHIWCVDKDEKGEVKKRKLFGVRYVPLTDAPKA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgcagctcgggcacctccaacagcgagctggtcgagaacctctggcgcaac
gagatgatcacccaccccgaggtgaaatccgcttttttaaaagtcgaccgcgcgcattat
gctcccaggtccccatatgaagactgtcctcagcctatagggcaccacgctactatttca
gcgccgcacatgcacgcctctgcggtggagcacttgctgcagtttataatgccgggcgag
gagaggccggcgccgagggtgctagatatagggagcggatcggggtatttgactcatgtg
cttgccgagctggtgggggagagggggagggtggtgggggtggagcatattgagccgttg
aaggagctgggggagaggaatatgaagaagtcgagggaggggagggagttgattgagggg
gggagggttaggtttagggttggggatgggaggaaggggtggagggatgaggaggaacag
gggaggaagagttgggatgcgattcatgtgggggcggcggcggtgaaggtgcatgaggag
ttgctggagcagttggctagcccggggaggatgtttattcctgtggatgatgaggatgat
ccgcaggggtggggacagcatatttggtgtgtggataaggatgagaagggggaggtgaaa
aagaggaagttgtttggggttaggtatgtgccattgacggatgcaccgaaggcttga

DBGET integrated database retrieval system