KEGG   Podospora anserina: PODANSg2195Help
Entry
PODANSg2195       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pan  Podospora anserina
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pan00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pan00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pan00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:pan00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 458 aa AA seqDB search
MASLAGRLLGLASLASAFVSRDGTGRLPAMGWNSWNEYECNISEGVFITVARQLVDLGLK
DLGYEYVNIDDCWSDKELRRDATTGELIPDAEKFPRGIVKVAEEVHSLGLKLGIYSDAGT
DTCGGYAGSLGYEELDAATFSKWGIDSEGQDLKYDNCNVPPEWADEYEYIPEEPANNAPP
GYDWGTSNTAKRYRVMHDALQRQNRTIQYSLCAWGHAHVERWGNSTGHSWRMWGDIFPAW
KGKEKWSWGLMPIVNQASLFWNYTDFGSHNDWDMLEVGNGDLTIEENRSHFALWCALKSA
LIVGTPLDTLALRKPILDILSNKELIDFNQDPVYGASAMPYKWGNDRPANTSDRDHPAAF
WVGTSVKGIHVFLLNTHDTAVNMRAVFAEIPPLKSGGKGYLVHDMWTGEDLGIFRKYFEL
EVKAHDTAALTITKADGKASSNGLRCLSSLTLSFRETS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcttgcagggcggctcctcgggctggcttctttggcttcagcctttgtcagt
cgagacgggaccggccgtctcccagctatgggatggaactcttggaacgagtacgaatgc
aacatcagcgagggagtcttcatcaccgtggccaggcagttggttgacttggggctcaag
gacctcggctatgaatacgtcaacattgatgattgctggagcgacaaagaactaagacgt
gacgcaacgaccggcgagttgatacccgacgccgagaaattccctcggggcattgtcaag
gtggcagaggaggtccactcactggggctgaagttgggcatctacagtgatgcaggcacc
gatacatgtggtggttacgcaggatcactcgggtatgaagaactggatgctgcaacattc
agcaaatggggcattgactcagagggccaagatctcaagtacgacaactgcaatgtgcca
ccagaatgggctgatgaatacgagtacatccccgaggaaccagccaacaatgccccccct
ggctatgactgggggacatccaacaccgctaaacgctaccgtgttatgcatgacgccctc
caaagacagaaccgcaccatccaatactcactctgcgcctggggccacgcacacgtcgag
cgctggggtaacagcaccggtcactcgtggagaatgtggggagacatcttccccgcgtgg
aagggcaaagagaaatggagctggggcctgatgccgattgtcaaccaggcatcactgttt
tggaattatactgatttcggaagccacaatgactgggacatgctcgaggttggcaatggg
gacctgacgatcgaggagaaccgcagccactttgctctttggtgtgctttgaaaagcgcg
cttatcgtcggaacccccctggatacattggcgttgagaaagcccattctcgacattctt
tccaacaaggagctgatcgacttcaaccaagacccggtttatggtgcttcggccatgccc
tacaaatggggcaacgacaggcccgccaacacgtcggacagggaccatccggctgctttt
tgggtgggcacatcggtcaaggggatccatgtttttctgctcaatacacatgacacggct
gtaaacatgcgggctgtctttgccgagatcccacccttgaagtctgggggcaagggttat
ttggtacacgacatgtggacaggggaggatctcgggatttttaggaagtattttgagttg
gaggtcaaggcgcatgatactgccgcgctgacaattaccaaggctgatggtaaggcatcg
tcaaatgggcttagatgtctcagctcgctgactttaagtttcagggaaacatcctaa

DBGET integrated database retrieval system