KEGG   Podospora anserina: PODANSg2310Help
Entry
PODANSg2310       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pan  Podospora anserina
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PODANSg2310
Messenger RNA biogenesis [BR:pan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     PODANSg2310
Translation factors [BR:pan03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PODANSg2310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 837 aa AA seqDB search
SRRLSSVCPVVEVIQVPGSSQQNQICGALLATLPKKTVLEPHHSLRSAQNLNYPDRHRSR
PRPATAQSSSQRDTPARFRSRPSQPRKSLPSMAPSYETLRDENLDEEDFDYDEVDVSDLK
EKYEVQLEQGYDTFVVIDGLPEVTEEQKPKLVKFLLKKLNTVGKTSEDAIFMPFGDHGKS
LRFAFVEYSSPAEAAAAVRQLDYSPLDKKHTLRVNKLTDIDRYGREGRIDEEYTPPTIEP
FQEKEHLRSFMADPSGRGRDQFVMYRGDTVGVFWNNEKDQPENIVDRPHWTETFVQWSPL
GTYLTSVHQQGVQLWGGASWTRIRRFAHPFVNLVAFSPNENYLVTWSNRPISIPDEGHPQ
LSIDDDGKNYVIWDIETGKPIRSFAQQDTPAGPDGEAKKPAKFPWPAFKWSADDKYVARL
NQGTSISVYELPRMNLLDKTTVKLDGVVDFDWAPATVKREGVKEYEQLFCFWTPEIGSNP
ARVGLMSIPSKQVVRSLNLFSVSDAKLHWQSEGAYLCVKVDRHSKSKKSQATTLEIFRIK
EKGVPVEVVDTIKDTVINFAWEPKGDRFVTITTTEPVGATAVPPKTSVAFFCPEKAKGNA
VGNFKHLRTLEKKNSNAIYWSPKGRFVVVATVHNTQSSDLHFYDLDFEGEKPESDKDLTA
NLQLMNTADHYGVTDVEWDPSGRYVATWASAWKHAMENGYHIYDFRGEQLREEPIEKFKQ
WAWRPRPATLLSKEEQKQIRKNLREYSRIFEQEDAERISSADVAVVQERRRLLEDWYNWR
EVVEEEVAEERAELGLPADPVEELLKAKTAEVAPNGEEQVIEEIMEEVLEETEEIVN
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
agccgtcgactctcttctgtctgtcctgtagtagaagtaatccaagtcccaggcagctcc
cagcagaaccaaatttgtggggctcttttggcaactctaccaaaaaaaaccgttctcgaa
ccccaccacagtctgcgcagcgcacaaaatctcaattatcccgaccgacatcgaagcaga
ccacgtccagcgacagcgcaatccagcagccaaagagacaccccagcccgttttcgcagt
agacccagccaaccgagaaagagtctgcccagcatggcgccgtcctatgagactctgcgc
gacgagaacctcgacgaggaggatttcgactacgacgaggttgatgtgtcggatctcaag
gagaaatatgaggtccagctcgagcagggctacgacacctttgtcgtcatcgacggcctt
cccgaggtcaccgaggagcagaagcccaagctcgtcaagttcttgttgaagaagctcaac
acggtcggcaagaccagcgaggatgccatcttcatgccctttggtgaccatggcaagtcg
ttgcgctttgcctttgtcgagtactcatcgcccgccgaggccgccgcagccgtgcgccag
ctcgactactcccctctcgacaagaagcacactctgcgcgtcaacaagctgaccgacatc
gaccgctatggccgtgagggtcgcatcgatgaggagtacactccccccaccatcgagcct
ttccaagaaaaggagcacctccgctccttcatggccgacccctcgggccgcggcagagat
cagttcgtcatgtacaggggagacacggtcggtgtgttttggaacaacgaaaaggaccag
cccgagaacattgtcgaccgcccacactggaccgagacctttgtgcaatggtcgcccctg
ggcacatatctcacctcagttcaccagcagggtgttcagctctggggtggtgcctcctgg
acgagaatcaggcgttttgcccatcccttcgttaacctcgttgccttctcgcccaacgaa
aactacctggttacgtggtccaacaggcctatttccattcctgatgagggccacccccag
ctgtctatcgacgatgatggaaagaactatgtgatctgggacatcgagaccggcaagccc
atccgttcttttgcccaacaggacacacccgccggacccgatggtgaggccaagaagccc
gccaagttcccctggccggcgttcaagtggtctgccgatgacaagtacgtcgccagactg
aaccagggaacatccatctctgtgtacgagcttcccaggatgaacctcctcgacaagacc
accgtgaagcttgacggcgtggtggactttgactgggcgcccgcgaccgtgaagagagaa
ggtgtgaaggagtatgagcagcttttctgcttctggacccccgagattggcagcaacccc
gccagagtcggtctcatgagcattccctccaagcaggtcgtcagatcgctcaacctcttc
agtgtttccgatgccaaacttcactggcagtcagagggtgcctacctctgcgttaaggtt
gacaggcattccaagtccaagaagtcccaggccaccactctggagattttccgcatcaag
gagaagggtgtccccgtcgaggttgtcgacaccatcaaggacacagtcatcaactttgcg
tgggagcccaagggtgacagattcgtcaccatcacgacgactgagcccgttggcgccacc
gctgttccccccaagacgtctgttgccttcttctgccccgaaaaggccaaagggaacgct
gttggtaacttcaagcacctccggacgctcgagaagaagaacagcaacgccatctactgg
tcgccaaagggcagattcgtcgttgtggccaccgtccacaacacgcagagctcggatctc
cacttctacgatctcgacttcgagggcgagaagccagagtcggacaaggacctgactgcc
aacttgcagcttatgaacactgctgaccactatggcgtcaccgacgtggagtgggacccc
tctggacgttacgttgccacctgggcctctgcctggaagcacgccatggagaacggatac
cacatctacgacttcaggggtgagcagctccgtgaagagcccattgagaagttcaagcaa
tgggcgtggcgtccccgcccggccactctcctcagcaaggaggagcagaagcagatccgc
aagaacctccgcgagtactcgagaatctttgagcaagaggatgccgagcgtatcagcagc
gccgacgtggctgtcgtccaggagagacgccgtctgctcgaggactggtacaactggcgc
gaggtggtggaggaggaggttgccgaggagcgtgccgagctcggcctccccgccgaccct
gtggaggagctcctcaaggccaagacggccgaggttgcgcccaacggtgaggagcaggtc
attgaggagatcatggaggaggtgctggaggagacggaggagattgtcaactag

DBGET integrated database retrieval system