KEGG   Podospora anserina: PODANSg2382Help
Entry
PODANSg2382       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K10868  
DNA repair protein XRS2
Organism
pan  Podospora anserina
Pathway
Homologous recombination
Non-homologous end-joining
Module
MRX complex
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PODANSg2382
   03450 Non-homologous end-joining
    PODANSg2382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 853 aa AA seqDB search
MWLLESDLFEAYLQLTRKPGKKLWLRPGKLYLFGRTVSEAGQLVISDKTISRKHITIKVE
PVPEGGGRNITSRSQITIEDLDSKKGTTVNDVQIRGQKKVLTETVNTVKLGMCQKLLRIQ
WYPVVLSFSFTSKELRADPWTKLRDDLEQLDIKYSAEYEETTTHVVSKKRNTSKGLQALI
NGKLIVTESFINTIINAATTPADAEEGSSSALEQDFDHHWPNALDHLPPRGEETGERPST
AYAPDERRQEVFEGYTFVFYEKKQFENLLSPITSGRGKAVLNAVTPGQTDVDDFVRFVKG
VAGEKGLGSFEDGSEGKGVVVVRYIPKDENYEWYAQFLTEFAQRLDHRPIDQREFIEAIL
DCDASMLRRPLEEASQSEPAMSRPEAHTEPGVRMEIDQPSTEPTAPQQREVEREPSPQPP
PRRVRTRRGVSRFKGFDIEDDNPEPTQEIGPVQPNLPELSQPAVEASQDGLFVSQYQDPL
DRPEEETAPESRPLPRATRKRPLSPLPEHDESALLANIAPTAAAAKRRRIQAGEPPVPPP
PEPEPPVKDEDNDEMVIEFPQDKSEKGRGTKGKGKKTAGGDDILELARKQREEAEARAAA
ERRALTELGDDEIDYAEIRRLQLETVQECEVRFPEPWTGGAGTSRTREQDIADGRWDPKW
NGRRNYKQFRKQGAATGRQASRTVIPLEEVRPKSNGIGDEYWLENDSNSRQKNDATSQRQ
SQTQQQTSNPTPEKAKAPLRENILTIDSSDEDEDDVDVMDEDRAAPEPTPEPARSRAAKA
AERANARKGQSQAQSTQTQSQSSNKRAAPPLNASPSSSREAKKPRRGGFMAASRDESDDD
SDDELKFRFGRRK
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctggagagcgatcttttcgaagcgtacctgcagctaacgcgcaaaccaggc
aagaagctctggctgcggcctggaaagctctacctcttcggccgcacggtatctgaggct
ggtcagctcgttatctctgacaagaccatttcgcgtaaacacatcaccatcaaggttgag
cctgtcccggaaggcggcggccgcaacattacctccagatcccagatcaccattgaagat
ctcgattcaaaaaagggaaccaccgtaaacgatgtccagatacgcggccagaagaaagtc
ctcaccgagactgtgaatacagtcaagctaggaatgtgccagaagcttctgcgcattcag
tggtaccccgttgtgctgagcttctccttcactagcaaggagttacgtgcagacccgtgg
acaaagcttcgcgatgatctcgaacaattggatataaaatactcggctgaatacgaagaa
accaccacccacgtcgtgtcaaagaagcgcaacacgtcgaaggggcttcaagctctcatt
aatggcaaacttattgtcaccgagagcttcatcaacaccatcatcaatgcagcaacaaca
ccagccgatgccgaggaaggctcgtcgagcgcgttggaacaagactttgatcaccattgg
cccaatgctctcgaccacttgccgccacgaggtgaagagaccggagaacgacccagcaca
gcctacgctccggatgaacggcgacaggaggtgtttgaagggtacacgtttgttttttac
gagaagaaacagtttgaaaacctcctctctcccatcacttctgggaggggtaaagcggtg
ttgaatgcagtgacgccaggacaaacggacgtggatgatttcgtccgtttcgtcaaaggc
gtggctggtgaaaaggggcttgggtcttttgaggatggcagcgaggggaagggagtggtg
gttgttcgatacatcccgaaagatgaaaactacgaatggtatgcgcagtttctcacagaa
tttgctcagcggctcgaccatcgaccaatcgaccagcgcgaatttattgaggcgatcctg
gactgcgatgcttccatgttgcgacgccccttggaagaggctagtcaatccgaaccggca
atgtcacgtcctgaagctcacacagaaccaggtgttcgcatggaaatagatcagccatcg
accgagccgacagccccccagcaaagagaggtggagagagaaccctcgccacaaccgcct
cctcgaagagtgcggactcgaagaggtgtaagcagattcaaaggctttgatatcgaggac
gacaaccccgagccgactcaagagataggccccgttcaacctaaccttcccgaactaagc
cagcccgcagtcgaagcgtcacaggatggtctgtttgtttcgcagtaccaggaccctctt
gatcgtccagaggaagagactgcacccgagtcgcgccctctgcctcgagctacgcgcaaa
cgcccactctcacccttgccagaacatgatgaatcggcattactagccaacattgccccc
acagccgcggcagccaaacgcaggcgtattcaggcaggagagccgcctgtgcccccacca
ccggaaccggagcctccagttaaggacgaggacaatgacgagatggtgattgaatttccc
caagacaaaagtgagaaggggcgaggtacgaaagggaaaggcaagaaaacagcaggcggt
gacgatatcttggagctggcgcgcaagcagcgcgaagaggccgaagccagagcagccgcg
gaacgtcgagcactgaccgagttgggcgatgatgagattgattatgcggaaattcgcagg
ctgcaacttgaaacggtccaggaatgtgaggttcgcttccctgagccatggacaggggga
gctggtaccagtcgtacgcgtgagcaggacattgccgacggtcgttgggatcccaaatgg
aatggtcgtaggaattacaagcagttccgaaagcaaggtgcagccactggacggcaagca
tcacgaacagtaattcccctagaagaggttcggccaaagagcaatggtatcggtgacgag
tattggctcgagaacgactccaacagtcgccaaaagaacgatgccaccagccaacgtcaa
tctcaaacgcagcagcaaaccagcaatcccacccccgagaaagccaaggcccctctcagg
gagaacattctcaccatcgacagcagtgatgaggacgaagatgatgtggatgttatggac
gaggaccgagcagcaccagagccaacacccgagccagcaaggtcgagggcggccaaggca
gcggagcgggccaatgctcggaagggccagtcacaggcacagagcacgcaaacgcagtcg
cagagcagcaacaagcgagcagcaccaccgctgaatgcctcacctagtagctcgagggaa
gcgaagaagccgcgtcggggagggttcatggctgccagtagagacgaaagcgacgacgac
agcgatgatgagttgaagttccggtttggcaggcggaagtga

DBGET integrated database retrieval system