KEGG   Podospora anserina: PODANSg2769Help
Entry
PODANSg2769       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pan  Podospora anserina
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PODANSg2769
  Replication and repair
   03420 Nucleotide excision repair
    PODANSg2769
Transcription machinery [BR:pan03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PODANSg2769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 540 aa AA seqDB search
MCRAASRHHVVLWPLVLLARRLLGEAARRNVSKAVPAAFHRLCYLSAHASTFRYTPPPSL
RTTVTNGHAPTAKVYVQALLYSPTPLTTNDIELWTRPEGKGTSNRAIARLRSLHIAQLSQ
STRAKKAQDIQLTANFKKSLRLALEGGGSHNSFGVPSTLPTDPKIHIQYLDQWAGRIWQD
ILYYVVNSVPMKANESGGRHGSGGGGPKRAVRELLKMGGLVREGAGGLVQISEHGFNFLL
QEANAQVWTLLLLWLEAADRNKALAKEQGTDITGTAIDNVEMLSFLFMLASLELGRAYDT
SALTETRKNMLPALADFGLIYIDRDRPQQYYPTRLATTLTSLSTMRSVSASIDAATKKTP
GDAGSLGADSTPTAPADENGGIVVETNYRIYAYTSSPLQIAILKLFCRLHMRFPNMVTAR
LTRESVQEAIKEGITANQIIDYLVAHAHPQMRRAAAARGTTVIPPTVMDQIRLWQLESQR
MQKTPGFQFKDFESVEEYRQLAEYATEIGVLVWKDDRKGTFFVSKVEQIREFLKARKKGN
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgggcagccagccgccatcatgtcgtcctttggcccctcgtccttcttgctcga
cgattacttggagaagctgccaggcgcaacgtttcgaaagctgtaccagcagccttccac
cgcctttgctatctttcggcgcatgcttccacctttaggtacacgcctcccccttctctc
cggaccaccgtgactaacggacacgcgcctacagcaaaggtatatgttcaggccctgcta
tacagtccgaccccccttacgacaaatgatatcgagctctggacgcgaccagaaggcaaa
ggcacgagcaatagagcgatcgcgaggctgcgctcactacacatcgcccagttatcacag
tcgaccagggccaagaaagcacaagatattcaactcacagccaacttcaaaaaatctcta
cgactcgccctcgagggcggcggatcacacaacagcttcggcgtaccaagcacattacct
accgacccaaagatacacatccaatatctcgaccaatgggccgggagaatatggcaagac
atcctttactacgtcgtcaacagcgtccccatgaaagccaacgagtccggcggccgacac
ggctccggaggcggcggcccaaaacgagcagtccgcgaactcctcaaaatgggcggtctc
gtccgcgaaggcgccggcggtctcgtccaaatcagcgagcatggcttcaacttcctcctc
caagaagccaacgcccaagtctggaccctcctcctcctctggctcgaagccgccgaccgc
aacaaagccctcgccaaagagcaaggcaccgacataacaggaacagccatcgacaatgtc
gaaatgctctcctttctcttcatgctcgcctccctcgagctcggccgcgcatacgacact
tctgctttgaccgaaacccgaaagaacatgctccccgcactggctgactttggcctgata
tacatcgaccgtgacagaccacagcaatactacccaacccgattagccaccactcttacc
tccttatcaaccatgaggtcagtatcagccagcatcgatgccgccacgaagaaaaccccc
ggtgacgcgggcagtctgggagcagactccaccccaacagcaccggcggatgaaaacggc
gggattgtagttgaaacaaactatcgtatctatgcttacacctcctcccctttgcaaatc
gccatcctcaagctgttctgccggctacacatgcggtttccaaacatggtcaccgccaga
ttgacgagagaatcagtccaggaagccatcaaggaagggatcacggcgaaccaaatcatt
gactaccttgtcgcgcatgcacacccacaaatgaggcgcgccgccgcggcgaggggcacg
acggtaatcccgccgacggtgatggatcagatccgactgtggcagctggagagtcagagg
atgcaaaagacgccagggttccagttcaaagacttcgagagcgtggaggagtacaggcag
ctggcggagtacgcgaccgagataggggtcttggtttggaaggatgatcggaaaggcacg
tttttcgtcagcaaggtggagcagattagggaattcttgaaggcaaggaagaaggggaat
tag

DBGET integrated database retrieval system