KEGG   Podospora anserina: PODANSg2947Help
Entry
PODANSg2947       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PODANSg2947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 642 aa AA seqDB search
MAEAQLMQEQLQLSVMQSEREAELAADGDVIMGEDISAAASQSQIDVGSLAGEHYEDAEM
DMDADGEPDDGGEEHDDHSSAQHSDSEQEEDGVFEEDAEEEEDNEVVPARGRQSRRGSKG
RTIRDEDAEEDEDEEDDEGVGAVKIKPGETDDESDSAHSADSASVSDNDSDAGAEEEWEP
ANNDEAEEDEDETDDGHCIFCKQSEENDPAEEFEVYLACTRCQDNAHQQCARDSKALDGE
TSRWSTNTSCRTVLTTAAGPESWKCPKCADTESESDAHNEEDVEMDGITDTSAPPSARRA
HAPKLARDLLPSQKGAVKPESHSVFNQLVLDEDPMDGSRVLRKRKTSSIEPDEHVMALRK
RRRTTTEEASNEEASVGREGSSRPVSRSLRLKILQSSGPASVTKKTRNSIIVKMRVNAVE
LARISSEKPKGLKKRPNRSNRSGRSGRSARRPSRNDGPRGAGAVQVPIATPFTSTSYSQP
FYSFYDRETDELKGKPYGGILTEPEADTSKTMPAPEDRRRFDEAKQKAEEEWRQRLLQVQ
AETEVPSKKSKKASGPASQIECIQFGGWEIDTWYAAPYPEEYSRNRILYICQFCLKYMNS
DYVTSRHKLKCPAKHPPGDEIYRHGSISWLICRRTVSVQREP
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctcagctcatgcaggagcagctacaactgagcgtcatgcagtcagagcgt
gaggctgaactcgccgcagatggggatgtgatcatgggggaggatatcagtgcggccgct
tctcagagtcagattgacgttgggagtctggcgggtgagcattacgaggatgcggagatg
gatatggatgccgatggggagcctgacgacggcggggaggaacacgacgatcacagcagt
gcccaacacagcgactcggagcaggaagaggatggggttttcgaggaggatgccgaggag
gaagaggataatgaggttgttcctgccagaggtcgccagtcgcgacgagggagcaagggg
aggacaataagggatgaggatgctgaagaggacgaggacgaggaagatgatgagggtgtc
ggggcggtcaagatcaagcctggcgagacagatgatgagtcggatagtgcccactctgcg
gattctgccagtgtcagtgacaatgactctgatgctggtgccgaggaggagtgggagccc
gcgaataatgatgaagcggaggaggatgaggatgagactgatgacggacactgcatcttc
tgtaagcagagtgaagaaaacgatccggcagaagagtttgaggtgtatttggcttgcacc
aggtgtcaggacaacgctcaccaacaatgtgcccgtgacagcaaggcattggatggcgaa
acgagtaggtggtctacgaatacatcgtgtagaaccgtgctgacaacagctgcaggtcct
gagagctggaagtgccccaagtgcgcagacactgaatcagaatccgacgcccataacgaa
gaagatgtcgagatggatggcatcactgacaccagtgctcctccatctgcccggcgtgca
catgcgccaaaactagcgagggacctgcttccgtcacaaaagggcgctgtcaagccggaa
tcacactctgtcttcaaccaactcgtcctcgacgaggatcctatggacggatcgcgcgtg
cttagaaagcggaaaacatcatcgatcgagcctgacgagcacgttatggccctgcgaaag
aggcgtcggacaacaacagaggaggcgagcaacgaggaagcctcagtcggcagggaagga
tcatctagaccagtgtcgcgatctttacggctcaagattttacagagctccggtcctgct
tctgtcacgaagaagacacggaacagcatcatcgtcaagatgcgcgtgaatgcggtggaa
ctcgctcggatctcatctgaaaagcccaagggccttaagaaacgacctaatagatctaat
aggtcggggagatcgggaagatcggcaaggcgaccatctagaaatgacgggcctcgcggt
gctggggcggtccaagtcccaatagccactccgtttactagcacgagctactctcagcca
ttttactctttctacgatagggagacggacgagctaaagggcaaaccatatggtggcatc
ttgaccgaacccgaagccgacacgtccaaaacgatgccggcacccgaagaccgacgtcgc
ttcgacgaggcaaagcaaaaggccgaagaagaatggagacagaggctgctgcaggtgcaa
gccgagactgaagtgccgagcaaaaagtctaagaaggcgtcgggcccggccagccagatc
gagtgcatccagtttggaggctgggagatcgacacgtggtacgcggcgccgtatcccgag
gagtacagcaggaaccggattctttacatttgtcagttttgcctcaagtacatgaactcg
gactatgtcacctcgaggcacaagctcaagtgtccggcgaagcaccctcctggggatgag
atttaccggcacgggtcaatttcttggttaatctgtcggcgaaccgtgtccgtccagcga
gaacct

DBGET integrated database retrieval system