KEGG   Podospora anserina: PODANSg2980Help
Entry
PODANSg2980       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pan  Podospora anserina
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PODANSg2980
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PODANSg2980
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PODANSg2980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 898 aa AA seqDB search
MARSRLVTVSPLLFAMLFVVVVLSSSFADCLVSLSLRAIGQMVIMGWDGTEVTPQIRHLI
EEHHLGSILLTAKNLKSAHQTAKLVQELQTIAHQAGHLQPLLIALDQENGGVNSLYDEDY
ICQFPSAMGQAAAGNADLAYKVAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRAVG
DDPQEVSQYGIAAMNGYKDAGVATCGKHFPSYGNLDFLGSSLDVPIITQTLEELSLSALV
PFRNAIATGKLDAMFVGGCGITNPSMNVNHACLSDQVVDDLLRNELGFTGVAISECLEME
ALRSEIGVKTGTVMAVEAGCDLVLLCRAYDVQLEAVAGLKLGVENELLTKERIYTSLRRV
LKMKNACTSWAKALNPPGISLLSKIHPSHLNLSINAYDDSITVIRDNEKLLPLNESMHQE
EELLLLTPLVKPLPASSLTKNILEAKNKSDSAPSEHDKWIHRDRGVIMSGEGVFRELGRS
LARARRGKLLHTSYTANGKKSLVVVAVSSPYDFAMDKSIGTYICTFDFTEMAMAALVRAL
CGSSRARGTLPGTLRKSRKAVKSRQHWLVEPYDRDRDSNGLNDLLSALARAAAPNHRFLT
TTTAHSFEIFNPNIEESHFVVRNSSTQALYGFCATYHTQGTGIIGAIFVDPTKRNVAIGR
SLHRRALRALIQKRGTKKIQLGICFPGVFLGIPTDDGGLKTWFSNSGWDLQFPRRLANMV
IADLSSWSAPEGLLQSIQRANMSFDLIHGLENAETVLAHVSGNANPEVFELYRLALQETK
SCGVVRAKCQRGGLVGTVVICSPGSQVAGYVPALQGGEEVLVGGIIAPVVAPGNGDLLVI
QGLALMGLRQNKAHKSGRSVLSWVGEEGMEGLGAMGWEVLEGWEEFTNSVENVSFLEG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatctcgactggtaaccgtttctcctttgctttttgccatgctgtttgttgtc
gtcgttctgagttcctcattcgctgactgtcttgtctctctctctctcagggccataggg
cagatggtgattatgggatgggatggcaccgaagtcactccgcagattcgtcatctcatc
gaggaacaccatctcggctccatccttctcacggcaaagaatctcaaatctgcccaccag
acggccaagctcgtgcaggagcttcagacgattgctcaccaagccggccatcttcaaccg
ctcttgattgccttggaccaggaaaatggcggcgtcaacagcctgtacgatgaggactac
atttgccagtttcccagcgccatgggccaagctgccgctggtaatgctgatctcgcatac
aaagtcgccaaagctacagccaccgaggtctcggccgtgggagtcaatctgattctcgga
cccgtgctcgacgttctgacaaacgctcgttaccagccgctcggtgtccgcgctgtcggg
gacgatccacaagaggtctcacaatatggcatcgcggctatgaacggctacaaggatgct
ggggtggccacttgtggaaaacactttccttcttatgggaatctcgactttctcgggtcc
agcttggatgttcccatcatcacccaaaccttggaggagttgtccctgagcgccctcgtg
ccttttcggaatgctattgctactggaaagttggatgccatgttcgttggcggctgtggc
atcacaaacccgtccatgaatgtgaaccacgcctgcctctccgatcaggtggttgatgac
cttctcagaaacgaacttggtttcacgggtgttgccatatcggaatgcttggagatggaa
gctcttcgaagtgaaatcggagtcaagactggcacggtcatggcggtagaagccggctgt
gacttggttctgctgtgtcgggcctacgacgtgcagctcgaagccgtagctggcctcaag
cttggtgtggaaaacgagctgctcaccaaggagcgtatttacacttctctccgccgtgtt
ctcaagatgaagaacgcgtgcacgtcctgggctaaagcgctgaacccgccaggaatttct
ctgttgtccaagattcacccgagtcatctcaacctctcaatcaacgcatatgatgactcc
atcacagttattagggataacgaaaagcttctgcccttgaatgagtcgatgcaccaggag
gaagagttgctactcctcaccccgttggtcaagcctttgccagcctcgtctttgaccaaa
aatatcctcgaggcgaagaacaagtccgatagcgcgccgtcggaacacgacaaatggata
caccgggatcggggcgtcataatgagtggcgagggggtgtttcgggagcttgggaggtca
cttgcccgcgctcgacgtggcaagctgctacatacctcttacactgcaaatggtaagaaa
tccctggtcgtggtggccgtcagctcgccctatgatttcgccatggacaagtcgattggg
acctatatctgcacctttgactttacggaaatggccatggcagctcttgtgcgcgctctc
tgcggaagctcgagagcacgcgggacgctgccggggactctgagaaaaagcagaaaggcc
gtgaagtcgaggcagcactggcttgtcgagccctatgacagggaccgcgactccaacggt
ctcaacgatcttttgagcgctcttgctcgtgctgctgccccgaaccatcggtttctgacc
acaacaacggcacactcgtttgagattttcaacccaaacattgaggagtcgcactttgtg
gttcgcaacagcagcacgcaggcgctgtacggattctgcgcgacgtatcacacccaaggg
accggcataatcggagcgatcttcgtggaccctaccaagcgcaacgttgccattgggcgt
tctctccatcgccgggcccttcgagcgttgattcagaagaggggcacaaagaagatacag
ctgggaatatgtttcccaggtgtgttcctgggcatcccgacagacgacggcgggctcaag
acgtggttttccaacagcggttgggacttgcagtttccgcgacggttggccaacatggtg
attgctgacttgagcagctggagcgcaccagagggtctgctgcagagcatccaacgggcg
aacatgagctttgatcttattcatgggttggagaacgccgagacggtgcttgcgcatgta
tccgggaatgcgaacccggaggtgtttgagctgtaccgtttggcgttgcaggagacaaag
tcgtgtggggttgttagggccaagtgccagaggggagggctggtggggacggtggttatt
tgtagtcctgggagtcaggttgcgggttatgtgccggctttgcaggggggggaggaggtg
ttggttggggggatcattgcgccggttgtggcgcctgggaatggggatttgttggtgatt
caggggctcgcgttgatggggttgagacagaacaaggcgcacaagtctgggaggagcgtg
ttgagctgggtgggggaggaagggatggaggggttgggggcgatggggtgggaggtgctg
gaggggtgggaggagtttactaattcggttgagaatgtgagttttcttgaggggtga

DBGET integrated database retrieval system