KEGG   Podospora anserina: PODANSg2980Help
Entry
PODANSg2980       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pan  Podospora anserina
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pan00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pan00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 898 aa AA seqDB search
MARSRLVTVSPLLFAMLFVVVVLSSSFADCLVSLSLRAIGQMVIMGWDGTEVTPQIRHLI
EEHHLGSILLTAKNLKSAHQTAKLVQELQTIAHQAGHLQPLLIALDQENGGVNSLYDEDY
ICQFPSAMGQAAAGNADLAYKVAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRAVG
DDPQEVSQYGIAAMNGYKDAGVATCGKHFPSYGNLDFLGSSLDVPIITQTLEELSLSALV
PFRNAIATGKLDAMFVGGCGITNPSMNVNHACLSDQVVDDLLRNELGFTGVAISECLEME
ALRSEIGVKTGTVMAVEAGCDLVLLCRAYDVQLEAVAGLKLGVENELLTKERIYTSLRRV
LKMKNACTSWAKALNPPGISLLSKIHPSHLNLSINAYDDSITVIRDNEKLLPLNESMHQE
EELLLLTPLVKPLPASSLTKNILEAKNKSDSAPSEHDKWIHRDRGVIMSGEGVFRELGRS
LARARRGKLLHTSYTANGKKSLVVVAVSSPYDFAMDKSIGTYICTFDFTEMAMAALVRAL
CGSSRARGTLPGTLRKSRKAVKSRQHWLVEPYDRDRDSNGLNDLLSALARAAAPNHRFLT
TTTAHSFEIFNPNIEESHFVVRNSSTQALYGFCATYHTQGTGIIGAIFVDPTKRNVAIGR
SLHRRALRALIQKRGTKKIQLGICFPGVFLGIPTDDGGLKTWFSNSGWDLQFPRRLANMV
IADLSSWSAPEGLLQSIQRANMSFDLIHGLENAETVLAHVSGNANPEVFELYRLALQETK
SCGVVRAKCQRGGLVGTVVICSPGSQVAGYVPALQGGEEVLVGGIIAPVVAPGNGDLLVI
QGLALMGLRQNKAHKSGRSVLSWVGEEGMEGLGAMGWEVLEGWEEFTNSVENVSFLEG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatctcgactggtaaccgtttctcctttgctttttgccatgctgtttgttgtc
gtcgttctgagttcctcattcgctgactgtcttgtctctctctctctcagggccataggg
cagatggtgattatgggatgggatggcaccgaagtcactccgcagattcgtcatctcatc
gaggaacaccatctcggctccatccttctcacggcaaagaatctcaaatctgcccaccag
acggccaagctcgtgcaggagcttcagacgattgctcaccaagccggccatcttcaaccg
ctcttgattgccttggaccaggaaaatggcggcgtcaacagcctgtacgatgaggactac
atttgccagtttcccagcgccatgggccaagctgccgctggtaatgctgatctcgcatac
aaagtcgccaaagctacagccaccgaggtctcggccgtgggagtcaatctgattctcgga
cccgtgctcgacgttctgacaaacgctcgttaccagccgctcggtgtccgcgctgtcggg
gacgatccacaagaggtctcacaatatggcatcgcggctatgaacggctacaaggatgct
ggggtggccacttgtggaaaacactttccttcttatgggaatctcgactttctcgggtcc
agcttggatgttcccatcatcacccaaaccttggaggagttgtccctgagcgccctcgtg
ccttttcggaatgctattgctactggaaagttggatgccatgttcgttggcggctgtggc
atcacaaacccgtccatgaatgtgaaccacgcctgcctctccgatcaggtggttgatgac
cttctcagaaacgaacttggtttcacgggtgttgccatatcggaatgcttggagatggaa
gctcttcgaagtgaaatcggagtcaagactggcacggtcatggcggtagaagccggctgt
gacttggttctgctgtgtcgggcctacgacgtgcagctcgaagccgtagctggcctcaag
cttggtgtggaaaacgagctgctcaccaaggagcgtatttacacttctctccgccgtgtt
ctcaagatgaagaacgcgtgcacgtcctgggctaaagcgctgaacccgccaggaatttct
ctgttgtccaagattcacccgagtcatctcaacctctcaatcaacgcatatgatgactcc
atcacagttattagggataacgaaaagcttctgcccttgaatgagtcgatgcaccaggag
gaagagttgctactcctcaccccgttggtcaagcctttgccagcctcgtctttgaccaaa
aatatcctcgaggcgaagaacaagtccgatagcgcgccgtcggaacacgacaaatggata
caccgggatcggggcgtcataatgagtggcgagggggtgtttcgggagcttgggaggtca
cttgcccgcgctcgacgtggcaagctgctacatacctcttacactgcaaatggtaagaaa
tccctggtcgtggtggccgtcagctcgccctatgatttcgccatggacaagtcgattggg
acctatatctgcacctttgactttacggaaatggccatggcagctcttgtgcgcgctctc
tgcggaagctcgagagcacgcgggacgctgccggggactctgagaaaaagcagaaaggcc
gtgaagtcgaggcagcactggcttgtcgagccctatgacagggaccgcgactccaacggt
ctcaacgatcttttgagcgctcttgctcgtgctgctgccccgaaccatcggtttctgacc
acaacaacggcacactcgtttgagattttcaacccaaacattgaggagtcgcactttgtg
gttcgcaacagcagcacgcaggcgctgtacggattctgcgcgacgtatcacacccaaggg
accggcataatcggagcgatcttcgtggaccctaccaagcgcaacgttgccattgggcgt
tctctccatcgccgggcccttcgagcgttgattcagaagaggggcacaaagaagatacag
ctgggaatatgtttcccaggtgtgttcctgggcatcccgacagacgacggcgggctcaag
acgtggttttccaacagcggttgggacttgcagtttccgcgacggttggccaacatggtg
attgctgacttgagcagctggagcgcaccagagggtctgctgcagagcatccaacgggcg
aacatgagctttgatcttattcatgggttggagaacgccgagacggtgcttgcgcatgta
tccgggaatgcgaacccggaggtgtttgagctgtaccgtttggcgttgcaggagacaaag
tcgtgtggggttgttagggccaagtgccagaggggagggctggtggggacggtggttatt
tgtagtcctgggagtcaggttgcgggttatgtgccggctttgcaggggggggaggaggtg
ttggttggggggatcattgcgccggttgtggcgcctgggaatggggatttgttggtgatt
caggggctcgcgttgatggggttgagacagaacaaggcgcacaagtctgggaggagcgtg
ttgagctgggtgggggaggaagggatggaggggttgggggcgatggggtgggaggtgctg
gaggggtgggaggagtttactaattcggttgagaatgtgagttttcttgaggggtga

DBGET integrated database retrieval system