KEGG   Podospora anserina: PODANSg2980Help
Entry
PODANSg2980       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pan  Podospora anserina
Pathway
pan00520  Amino sugar and nucleotide sugar metabolism
pan00531  Glycosaminoglycan degradation
pan01100  Metabolic pathways
pan01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PODANSg2980
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PODANSg2980
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PODANSg2980
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PODANSg2980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Acetyltransf_1 PGPGW Glyco_hydro_3_C Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 6190037
NCBI-ProteinID: XP_001905952
UniProt: B2AR40
Position
4
AA seq 898 aa AA seqDB search
MARSRLVTVSPLLFAMLFVVVVLSSSFADCLVSLSLRAIGQMVIMGWDGTEVTPQIRHLI
EEHHLGSILLTAKNLKSAHQTAKLVQELQTIAHQAGHLQPLLIALDQENGGVNSLYDEDY
ICQFPSAMGQAAAGNADLAYKVAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRAVG
DDPQEVSQYGIAAMNGYKDAGVATCGKHFPSYGNLDFLGSSLDVPIITQTLEELSLSALV
PFRNAIATGKLDAMFVGGCGITNPSMNVNHACLSDQVVDDLLRNELGFTGVAISECLEME
ALRSEIGVKTGTVMAVEAGCDLVLLCRAYDVQLEAVAGLKLGVENELLTKERIYTSLRRV
LKMKNACTSWAKALNPPGISLLSKIHPSHLNLSINAYDDSITVIRDNEKLLPLNESMHQE
EELLLLTPLVKPLPASSLTKNILEAKNKSDSAPSEHDKWIHRDRGVIMSGEGVFRELGRS
LARARRGKLLHTSYTANGKKSLVVVAVSSPYDFAMDKSIGTYICTFDFTEMAMAALVRAL
CGSSRARGTLPGTLRKSRKAVKSRQHWLVEPYDRDRDSNGLNDLLSALARAAAPNHRFLT
TTTAHSFEIFNPNIEESHFVVRNSSTQALYGFCATYHTQGTGIIGAIFVDPTKRNVAIGR
SLHRRALRALIQKRGTKKIQLGICFPGVFLGIPTDDGGLKTWFSNSGWDLQFPRRLANMV
IADLSSWSAPEGLLQSIQRANMSFDLIHGLENAETVLAHVSGNANPEVFELYRLALQETK
SCGVVRAKCQRGGLVGTVVICSPGSQVAGYVPALQGGEEVLVGGIIAPVVAPGNGDLLVI
QGLALMGLRQNKAHKSGRSVLSWVGEEGMEGLGAMGWEVLEGWEEFTNSVENVSFLEG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatctcgactggtaaccgtttctcctttgctttttgccatgctgtttgttgtc
gtcgttctgagttcctcattcgctgactgtcttgtctctctctctctcagggccataggg
cagatggtgattatgggatgggatggcaccgaagtcactccgcagattcgtcatctcatc
gaggaacaccatctcggctccatccttctcacggcaaagaatctcaaatctgcccaccag
acggccaagctcgtgcaggagcttcagacgattgctcaccaagccggccatcttcaaccg
ctcttgattgccttggaccaggaaaatggcggcgtcaacagcctgtacgatgaggactac
atttgccagtttcccagcgccatgggccaagctgccgctggtaatgctgatctcgcatac
aaagtcgccaaagctacagccaccgaggtctcggccgtgggagtcaatctgattctcgga
cccgtgctcgacgttctgacaaacgctcgttaccagccgctcggtgtccgcgctgtcggg
gacgatccacaagaggtctcacaatatggcatcgcggctatgaacggctacaaggatgct
ggggtggccacttgtggaaaacactttccttcttatgggaatctcgactttctcgggtcc
agcttggatgttcccatcatcacccaaaccttggaggagttgtccctgagcgccctcgtg
ccttttcggaatgctattgctactggaaagttggatgccatgttcgttggcggctgtggc
atcacaaacccgtccatgaatgtgaaccacgcctgcctctccgatcaggtggttgatgac
cttctcagaaacgaacttggtttcacgggtgttgccatatcggaatgcttggagatggaa
gctcttcgaagtgaaatcggagtcaagactggcacggtcatggcggtagaagccggctgt
gacttggttctgctgtgtcgggcctacgacgtgcagctcgaagccgtagctggcctcaag
cttggtgtggaaaacgagctgctcaccaaggagcgtatttacacttctctccgccgtgtt
ctcaagatgaagaacgcgtgcacgtcctgggctaaagcgctgaacccgccaggaatttct
ctgttgtccaagattcacccgagtcatctcaacctctcaatcaacgcatatgatgactcc
atcacagttattagggataacgaaaagcttctgcccttgaatgagtcgatgcaccaggag
gaagagttgctactcctcaccccgttggtcaagcctttgccagcctcgtctttgaccaaa
aatatcctcgaggcgaagaacaagtccgatagcgcgccgtcggaacacgacaaatggata
caccgggatcggggcgtcataatgagtggcgagggggtgtttcgggagcttgggaggtca
cttgcccgcgctcgacgtggcaagctgctacatacctcttacactgcaaatggtaagaaa
tccctggtcgtggtggccgtcagctcgccctatgatttcgccatggacaagtcgattggg
acctatatctgcacctttgactttacggaaatggccatggcagctcttgtgcgcgctctc
tgcggaagctcgagagcacgcgggacgctgccggggactctgagaaaaagcagaaaggcc
gtgaagtcgaggcagcactggcttgtcgagccctatgacagggaccgcgactccaacggt
ctcaacgatcttttgagcgctcttgctcgtgctgctgccccgaaccatcggtttctgacc
acaacaacggcacactcgtttgagattttcaacccaaacattgaggagtcgcactttgtg
gttcgcaacagcagcacgcaggcgctgtacggattctgcgcgacgtatcacacccaaggg
accggcataatcggagcgatcttcgtggaccctaccaagcgcaacgttgccattgggcgt
tctctccatcgccgggcccttcgagcgttgattcagaagaggggcacaaagaagatacag
ctgggaatatgtttcccaggtgtgttcctgggcatcccgacagacgacggcgggctcaag
acgtggttttccaacagcggttgggacttgcagtttccgcgacggttggccaacatggtg
attgctgacttgagcagctggagcgcaccagagggtctgctgcagagcatccaacgggcg
aacatgagctttgatcttattcatgggttggagaacgccgagacggtgcttgcgcatgta
tccgggaatgcgaacccggaggtgtttgagctgtaccgtttggcgttgcaggagacaaag
tcgtgtggggttgttagggccaagtgccagaggggagggctggtggggacggtggttatt
tgtagtcctgggagtcaggttgcgggttatgtgccggctttgcaggggggggaggaggtg
ttggttggggggatcattgcgccggttgtggcgcctgggaatggggatttgttggtgatt
caggggctcgcgttgatggggttgagacagaacaaggcgcacaagtctgggaggagcgtg
ttgagctgggtgggggaggaagggatggaggggttgggggcgatggggtgggaggtgctg
gaggggtgggaggagtttactaattcggttgagaatgtgagttttcttgaggggtga

DBGET integrated database retrieval system