KEGG   Podospora anserina: PODANSg3101Help
Entry
PODANSg3101       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pan  Podospora anserina
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pan00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 590 aa AA seqDB search
MGDLGDFNPIRFEEGGMVIDIPTLNLDSLKKPEATITPLYPDHIPTLETPNLHPHHDKHL
PRGIEETPEEQRRHWFVGSIDQGTTSSRFLIFNGEGDPVASHQLEFENLYPKSGWHEHEP
LELLASVEECIDEAMRKFVDLGYRKSDIRSIGITNQRETTVVWDNNTGEPLYNAIVWPDT
RTKDLVRDLKSRDQADTLTDLCGLPLSTYPSSVKLMWLIENVEAVKQAYEEGRLAFGTVD
SWLIYKLNGGAKAAKPIHVTDSTNASRTMFMNLHTLQYDDNLLKFFGIDRSKIHLPKIVP
SSDPCCFGKIAKGALSGVQIAGCLGDQSSALVGQCGFSPGQAKNTYGTGCFLLYNVGTKP
VISKYGLLATVAYDFGGGRKPVYALEGSIAVAGSGVKFLMNNLGFVDKSSAITELAESVE
DNGGVVFVTAFSGLFAPYWIDDAKGTIFGITQHTQKGHIARATLEATCFQTKAILDAMEK
DSNAKLESLAVDGGLSNSDLCMQTQADITGIPVDRPGMRETTALGAAIAAGLATGVWKEL
NDLKDVNQAGRKVFKPNMERKQAEKLFKKWEQAVEMSRGWVNEVADGEEE
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccttggcgacttcaaccccattcgcttcgaagaaggcggcatggtgatagac
atacccacgctgaacctcgactccctgaagaagcccgaagcaaccatcacccctctgtac
cccgaccacattcccaccctcgagacgcccaacttacatccgcaccatgataagcacctg
ccgcggggcattgaggagacacctgaggaacagcggcgccactggtttgtgggcagtatc
gaccagggaacaacgtcatctcggttcctaatattcaacggagaaggcgacccagttgcc
agtcaccaactcgagttcgagaacctgtatcctaaatccggatggcacgagcacgaaccg
ttggagcttctcgcctccgtggaggaatgcatcgatgaggcgatgcgcaagtttgtcgat
ctggggtaccgaaaatcagacattcggtccattggcatcaccaatcaaagagaaacgaca
gtagtatgggacaacaacaccggcgagcccctttacaacgccattgtctggcccgatacc
agaaccaaagatctggtgagggacctcaagtcccgtgaccaggccgacacattgacagac
ctttgtggtctgccgctatcaacatatcccagcagtgtcaagctcatgtggctcatcgaa
aacgtcgaggccgtaaaacaggcttatgaggagggtcgcctcgcctttggaacagtcgac
tcatggctgatatataagctcaacggcggggccaaggcggcaaagcccatccatgtcacc
gatagcacaaatgctagcagaaccatgtttatgaatctgcacactctccagtacgacgac
aatctgctcaagttctttggtatcgacagaagcaagatccaccttcccaagatcgttcca
tcatcagatccatgttgctttggaaaaattgccaagggcgcattgtcgggagtgcagatt
gccgggtgcctgggagaccagtctagtgcgttggtcggccagtgtggtttcagtccgggt
caagccaaaaacacctacggcaccggttgcttcttactctacaacgttggtaccaagccg
gtcatttcaaaatatggtcttttggcaacagtcgcctacgactttggtggtggccgcaag
cccgtctacgccttggagggaagcatagccgtcgccggatccggtgtcaagttcctcatg
aacaacttgggatttgttgacaagtcaagcgccatcactgagctggccgaatcagtcgag
gataacggcggtgttgtttttgtcaccgctttcagtggtctgtttgccccctattggatt
gatgatgccaagggcacaatttttggcatcacgcaacacacacaaaaaggtcacattgct
cgggccacactggaagccacgtgtttccagacgaaggccatcttggacgccatggaaaag
gactccaatgccaaactcgagtctcttgcggttgatggtggcctgtcaaactctgacctc
tgcatgcaaacgcaggccgatatcacgggaatcccggttgatcgtccaggcatgagagag
acgacagccttgggtgcagccattgctgctgggctggcaacaggtgtctggaaggagttg
aatgacctgaaggatgtgaatcaggccggtaggaaggtgttcaagccgaatatggagagg
aaacaagcagagaaactgttcaagaagtgggagcaagctgttgagatgagcagggggtgg
gttaatgaggttgccgatggtgaggaggagtga

DBGET integrated database retrieval system