KEGG   Podospora anserina: PODANSg3101Help
Entry
PODANSg3101       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pan  Podospora anserina
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PODANSg3101
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PODANSg3101
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PODANSg3101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 590 aa AA seqDB search
MGDLGDFNPIRFEEGGMVIDIPTLNLDSLKKPEATITPLYPDHIPTLETPNLHPHHDKHL
PRGIEETPEEQRRHWFVGSIDQGTTSSRFLIFNGEGDPVASHQLEFENLYPKSGWHEHEP
LELLASVEECIDEAMRKFVDLGYRKSDIRSIGITNQRETTVVWDNNTGEPLYNAIVWPDT
RTKDLVRDLKSRDQADTLTDLCGLPLSTYPSSVKLMWLIENVEAVKQAYEEGRLAFGTVD
SWLIYKLNGGAKAAKPIHVTDSTNASRTMFMNLHTLQYDDNLLKFFGIDRSKIHLPKIVP
SSDPCCFGKIAKGALSGVQIAGCLGDQSSALVGQCGFSPGQAKNTYGTGCFLLYNVGTKP
VISKYGLLATVAYDFGGGRKPVYALEGSIAVAGSGVKFLMNNLGFVDKSSAITELAESVE
DNGGVVFVTAFSGLFAPYWIDDAKGTIFGITQHTQKGHIARATLEATCFQTKAILDAMEK
DSNAKLESLAVDGGLSNSDLCMQTQADITGIPVDRPGMRETTALGAAIAAGLATGVWKEL
NDLKDVNQAGRKVFKPNMERKQAEKLFKKWEQAVEMSRGWVNEVADGEEE
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccttggcgacttcaaccccattcgcttcgaagaaggcggcatggtgatagac
atacccacgctgaacctcgactccctgaagaagcccgaagcaaccatcacccctctgtac
cccgaccacattcccaccctcgagacgcccaacttacatccgcaccatgataagcacctg
ccgcggggcattgaggagacacctgaggaacagcggcgccactggtttgtgggcagtatc
gaccagggaacaacgtcatctcggttcctaatattcaacggagaaggcgacccagttgcc
agtcaccaactcgagttcgagaacctgtatcctaaatccggatggcacgagcacgaaccg
ttggagcttctcgcctccgtggaggaatgcatcgatgaggcgatgcgcaagtttgtcgat
ctggggtaccgaaaatcagacattcggtccattggcatcaccaatcaaagagaaacgaca
gtagtatgggacaacaacaccggcgagcccctttacaacgccattgtctggcccgatacc
agaaccaaagatctggtgagggacctcaagtcccgtgaccaggccgacacattgacagac
ctttgtggtctgccgctatcaacatatcccagcagtgtcaagctcatgtggctcatcgaa
aacgtcgaggccgtaaaacaggcttatgaggagggtcgcctcgcctttggaacagtcgac
tcatggctgatatataagctcaacggcggggccaaggcggcaaagcccatccatgtcacc
gatagcacaaatgctagcagaaccatgtttatgaatctgcacactctccagtacgacgac
aatctgctcaagttctttggtatcgacagaagcaagatccaccttcccaagatcgttcca
tcatcagatccatgttgctttggaaaaattgccaagggcgcattgtcgggagtgcagatt
gccgggtgcctgggagaccagtctagtgcgttggtcggccagtgtggtttcagtccgggt
caagccaaaaacacctacggcaccggttgcttcttactctacaacgttggtaccaagccg
gtcatttcaaaatatggtcttttggcaacagtcgcctacgactttggtggtggccgcaag
cccgtctacgccttggagggaagcatagccgtcgccggatccggtgtcaagttcctcatg
aacaacttgggatttgttgacaagtcaagcgccatcactgagctggccgaatcagtcgag
gataacggcggtgttgtttttgtcaccgctttcagtggtctgtttgccccctattggatt
gatgatgccaagggcacaatttttggcatcacgcaacacacacaaaaaggtcacattgct
cgggccacactggaagccacgtgtttccagacgaaggccatcttggacgccatggaaaag
gactccaatgccaaactcgagtctcttgcggttgatggtggcctgtcaaactctgacctc
tgcatgcaaacgcaggccgatatcacgggaatcccggttgatcgtccaggcatgagagag
acgacagccttgggtgcagccattgctgctgggctggcaacaggtgtctggaaggagttg
aatgacctgaaggatgtgaatcaggccggtaggaaggtgttcaagccgaatatggagagg
aaacaagcagagaaactgttcaagaagtgggagcaagctgttgagatgagcagggggtgg
gttaatgaggttgccgatggtgaggaggagtga

DBGET integrated database retrieval system