KEGG   Podospora anserina: PODANSg3105Help
Entry
PODANSg3105       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pan  Podospora anserina
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PODANSg3105
   00500 Starch and sucrose metabolism
    PODANSg3105
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PODANSg3105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 321 aa AA seqDB search
MHLLPLLLPLLGLIPSTAAQARTTPPSSSCIRVSKTPSAHSAQFSTLSSAITSLSTTSTS
PVCIFLYPGTYQEQVLIPAAVKSTISIYGSTTNSASYTSNSVTITQSKSQANTGASNDET
GTVRVKANNVKIYNLNIVNSYGKGSQAVALSAYADSGYYGCSFQGYQDTVLANRGKQYYS
RCEIVGVTDFIFGQESPAWFERSNSASPNFYVFNNCNIAAKSGQSVNNGAFYLGRPWREY
ARVVFQNTTMSGVVNGAGWRIWNAGDERTSNVYFGEYANSGPGAGGTRASFARRLGGPVA
IETVLGGDYKGQGWFDGNYGM
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcctccccctcctcctcccccttctcgggctgatcccctcaacggcagcccaa
gctcgcaccacccccccatcctcctcctgcatccgcgtatccaagaccccctcagcccac
tcggcccaattctcaaccctctcctccgccatcacctccctctccacaacctccacctcc
cccgtctgcatcttcctctaccccggcacctaccaagaacaagtcctcatccccgccgcc
gtcaaatccaccatctccatctacggctcaaccaccaactcagcctcctacacctcaaac
tccgtaacaataacccagtccaaatcccaagccaacaccggcgcctccaacgacgagacg
ggcaccgtccgtgtaaaagccaacaacgtcaagatctacaacctcaatatcgtaaactcc
tacggcaaggggtcgcaagccgtagccctgtccgcgtacgccgacagcggctactacggc
tgctccttccaggggtatcaagacaccgtcctcgccaaccgggggaagcagtactattcc
cgctgcgagatcgtcggggtgacggactttatttttggacaggaaagcccggcttggttt
gagagatcaaactccgcctcgccaaacttctatgtcttcaacaactgcaacatcgcagcc
aagtcagggcagagcgtgaacaacggggcgttttacctgggtaggccgtggagggagtac
gccagggttgtgtttcagaatacgaccatgagtggtgttgtcaatggggcgggatggagg
atttggaatgcgggggatgagaggacgtcgaatgtttactttggggagtatgccaactcg
ggcccgggggcgggcgggacgagggcgagctttgcgaggaggttggggggtccggtggca
atcgagacggtgctggggggggactataagggccagggctggtttgatgggaattatgga
atgtga

DBGET integrated database retrieval system