KEGG   Podospora anserina: PODANSg3105Help
Entry
PODANSg3105       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pan  Podospora anserina
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pan00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pan00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 321 aa AA seqDB search
MHLLPLLLPLLGLIPSTAAQARTTPPSSSCIRVSKTPSAHSAQFSTLSSAITSLSTTSTS
PVCIFLYPGTYQEQVLIPAAVKSTISIYGSTTNSASYTSNSVTITQSKSQANTGASNDET
GTVRVKANNVKIYNLNIVNSYGKGSQAVALSAYADSGYYGCSFQGYQDTVLANRGKQYYS
RCEIVGVTDFIFGQESPAWFERSNSASPNFYVFNNCNIAAKSGQSVNNGAFYLGRPWREY
ARVVFQNTTMSGVVNGAGWRIWNAGDERTSNVYFGEYANSGPGAGGTRASFARRLGGPVA
IETVLGGDYKGQGWFDGNYGM
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcctccccctcctcctcccccttctcgggctgatcccctcaacggcagcccaa
gctcgcaccacccccccatcctcctcctgcatccgcgtatccaagaccccctcagcccac
tcggcccaattctcaaccctctcctccgccatcacctccctctccacaacctccacctcc
cccgtctgcatcttcctctaccccggcacctaccaagaacaagtcctcatccccgccgcc
gtcaaatccaccatctccatctacggctcaaccaccaactcagcctcctacacctcaaac
tccgtaacaataacccagtccaaatcccaagccaacaccggcgcctccaacgacgagacg
ggcaccgtccgtgtaaaagccaacaacgtcaagatctacaacctcaatatcgtaaactcc
tacggcaaggggtcgcaagccgtagccctgtccgcgtacgccgacagcggctactacggc
tgctccttccaggggtatcaagacaccgtcctcgccaaccgggggaagcagtactattcc
cgctgcgagatcgtcggggtgacggactttatttttggacaggaaagcccggcttggttt
gagagatcaaactccgcctcgccaaacttctatgtcttcaacaactgcaacatcgcagcc
aagtcagggcagagcgtgaacaacggggcgttttacctgggtaggccgtggagggagtac
gccagggttgtgtttcagaatacgaccatgagtggtgttgtcaatggggcgggatggagg
atttggaatgcgggggatgagaggacgtcgaatgtttactttggggagtatgccaactcg
ggcccgggggcgggcgggacgagggcgagctttgcgaggaggttggggggtccggtggca
atcgagacggtgctggggggggactataagggccagggctggtttgatgggaattatgga
atgtga

DBGET integrated database retrieval system