KEGG   Podospora anserina: PODANSg3214Help
Entry
PODANSg3214       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
pan  Podospora anserina
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pan00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PODANSg3214
Enzymes [BR:pan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PODANSg3214
Peptidases [BR:pan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PODANSg3214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 972 aa AA seqDB search
MMDHAGSSRAGPTNGGLPNGGGNGTRRPLPHIDDITSVEVDLDPHAPIERVVQMAENYLR
QAESSKTFGRPDLALKDYIRASIIVLDLIKKNKGWVSMQRDSRALHDRYTRVLRQLDATH
TEFERIKMEIKADNARTCVQPTAQRQSRNGGHMINGNDFERTNGATNGTSSDQSFSPLSP
PRMKPVVGPKPQGLHGNAISKPSAKAQDLAQRFANLRTTTVQTTQDPRVRTQPIVSPTTA
VAPGSPPPLFSQTSLGGLPRMPDAIYNPPRGTVSKEAAALPSSTPRAMFSRTGSVSSINI
TKAPRPSMAGEIFSTAQSFDRPTSNKRTKLSLPNFYDETISVKDLLQYQQAGSKEISILI
VDIRSREEFDEGHILSQATICVEPEVLSRPHISGEDIANSMVLAPASEQLLFEKRADFDL
VVFYDQDSTAVPATPSNSIEHTVFNFFGALSFYDFVGERAAKSRPKLLEGGLDAWTSMVG
KASLQTSSTIDPTAKQASTAMTRSFLNQKQKYAARPIQNPEEAKRWEKHISDPASIIPIR
TTEDFLRRYPPVSGQKESMVSSSAPSPPSQSLESPLYDRISRDENFYSSLPSPPARPAPA
VPRRSHSGLSDEPVLAKAVGIAPGAARPEVRKNRTGLYNPGVHCFANSSLQSLFATPGFC
KEVYDGSWRHNYKAPKKLDETIDNPQLLMKCLENLFQWINTGSFKYIHAKTFMTNTRRDR
VTNVRDEYTPNEGTAVQNAVKFWNNYVEGHNSLVTKYFRGVDVYINTCSKCNHQFQKFEV
SDMRILNFPDGASDPISMLKLLEQSAAPEKMDGARCEKCNSTKHRTRARKFARLPDRLVF
SFQRSINQFDKMQNIVQFPTQGLDVRPYFAGAANEHVDPRDEHYEGDMVYDLYAVTVHIG
ETTTSGHYIEYVRDDRSSDPESWWKCNDRDVTPLKVGPKNPRNLEQLYGDSAANATAYLV
FYERRGTRNQDV
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgatggaccatgcaggatcctcgcgcgcggggccaacaaatggtgggcttccaaatgga
ggaggaaatgggacgagaaggccgcttccacacattgacgacatcacgtcggttgaagtc
gacctcgaccctcatgctccgattgagcgagtggtgcaaatggccgaaaactatcttcga
caggctgaatcatcaaagacgtttggtcgtcctgaccttgccctcaaagactatatacgg
gccagtatcattgtgttggatctgatcaagaagaacaaaggctgggtgtcgatgcagagg
gattccagggcgcttcatgaccggtacactcgtgtgttaaggcagcttgatgctacgcat
accgagttcgagaggatcaagatggaaatcaaggcagacaatgctaggacttgtgtccaa
ccaaccgcccagaggcagagtcggaatgggggacatatgattaacgggaacgatttcgaa
aggacaaacggcgcaacaaatggcacgtcatcggaccagagtttctcccccttgtcgcct
ccgagaatgaagccggtggtgggccctaaaccacagggtctccatggcaatgcaatctcc
aagccctcggccaaagcgcaggacctggcccaacggtttgcgaatttgaggacaaccaca
gtacagacgacccaagacccccgcgtccgaacccagccgatcgtgtcaccaacaacggcg
gtagcacccggcagtccacctccattgttctcgcaaacgtctctcggcgggttaccgcga
atgccagatgccatttacaatccacccaggggcaccgtttcgaaggaggcagccgcactg
ccttccagtactccccgtgccatgttctctaggacaggttcggtgtcgtccatcaacatt
accaaagccccaagaccgtccatggcaggagagatattttcgacagctcaaagcttcgac
aggccgacatcaaacaagagaacaaaactctcattacccaacttctacgatgaaacgata
tccgtcaaggatctgctccagtaccagcaggcaggctccaaggagatatcaatattaata
gtggacattaggagtcgtgaagaatttgacgaaggtcacattctatctcaggccaccata
tgcgtggagcccgaggtactatcgagaccgcacatctcgggcgaggacattgccaatagc
atggtactggcgcccgcaagtgaacagcttctctttgagaaacgggccgactttgatctg
gtggtcttttatgatcaggactcgaccgcggttcccgcaacaccatcaaacagcatagag
cacaccgtattcaactttttcggcgccctcagcttttatgactttgtcggcgaaagagct
gccaaatcacggcctaaactgctcgaaggcgggctggatgcatggacgagcatggttgga
aaggccagcttgcagacatcatcaaccatcgatccaaccgcgaagcaggcatccactgcc
atgaccaggtcattcttgaaccaaaaacagaagtatgctgcacgacccatccagaatccc
gaggaagccaaacgctgggaaaagcacatttccgatcccgcatccataatacccatccga
acaaccgaagactttctccgtcgctacccgccggtatcaggacagaaagagtccatggtt
tcttcgtctgcgccgtcgccacctagccaaagtttagaaagtcccctctatgatcgaata
tcccgcgatgagaatttctacagctccctaccatccccaccggctcgtcccgcccctgcg
gttcctcgccgtagtcatagcggactgtcagatgaacctgttctagcaaaggcggtcgga
atcgcccccggcgccgcaaggcccgaagtgcggaaaaatcgcaccggtctctacaaccca
ggagttcattgctttgccaacagctcacttcagtcattgtttgccacgcctggtttctgc
aaagaggtatacgatggatcgtggaggcacaactacaaagctccgaaaaagctggacgaa
accattgacaacccccaactcttgatgaaatgtttggaaaatctcttccagtggatcaac
accggatctttcaagtatatccatgccaagaccttcatgacaaacactcgtcgagatcgg
gtgacaaacgtgcgagacgagtacacacctaacgaaggcaccgctgtccaaaacgcagta
aaattctggaacaactacgttgaaggtcacaactctttggtgaccaaatacttccgtggt
gtggatgtgtacatcaacacctgctccaagtgcaaccaccagttccaaaagtttgaggtc
tccgacatgcgaatcctcaatttccctgatggcgcgtcagatcccatcagcatgctgaag
ctgcttgaacagagcgccgcgccagagaaaatggacggcgccagatgtgagaaatgcaac
tcgacaaagcaccgcactcgagcccgcaagttcgcccgactaccggatcggcttgtcttt
tcctttcagcgcagcattaatcaattcgacaagatgcaaaacatagtacagttcccgacc
caagggcttgacgtgcgtccttattttgccggcgcggcaaacgaacacgtcgacccccgc
gatgaacactacgagggtgacatggtgtatgacctctatgctgtgacggtgcacattggc
gagacaactacctcggggcattatatcgagtacgtcagggatgatcggagcagtgatccg
gagagctggtggaagtgcaatgatcgggatgtcacgccgctcaaggtcgggccgaagaac
cccaggaatcttgagcagctttatggggattcggcggcgaatgctacggcgtatttggtg
ttttatgagaggagggggacaaggaatcaagatgtttga

DBGET integrated database retrieval system