KEGG   Podospora anserina: PODANSg3584Help
Entry
PODANSg3584       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pan  Podospora anserina
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PODANSg3584
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODANSg3584
  Lipid metabolism
   00071 Fatty acid degradation
    PODANSg3584
  Amino acid metabolism
   00350 Tyrosine metabolism
    PODANSg3584
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PODANSg3584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 337 aa AA seqDB search
MTLKTIPVPTPGPQEILIHILYSGVCHTDLHALNNDWPLPRKTPLVGGHEGAGVVVAKGS
LVASGQGVDVGDYVGIPWLNSTCHHCTFCMQAQEMLCSEAQLSGYTVDGSFQQYAVANAS
HVAKFPKDKGVELDAAAPILCAGLTVYTGLKQSEARPGQYVAIVGAGGGLGSLATQYAKA
MGLHVIAIDGGPEKGESCKKLGAEVYVDYLKSKDLVADVKAATADGLGPHGVLLLAPMEK
PFQQATGYVRSHGTVVCIGMPAGAKVSMPVFDTVVRMVQVKGSYVGNRQDMVEAIDFFLR
GLVRAPVKVVGMSELGGVFDAMRENKVVGRYVLDTSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaaaaaccatccccgtccccactccgggcccccaagaaatcctgatccatatt
ttgtactcgggcgtctgccacaccgacctccacgccctcaacaacgactggcccctgccc
cgcaagacccccctggtgggcggtcacgaaggcgccggcgtcgtggtggccaaaggaagc
ctggttgcttcgggccagggcgtcgatgtcggagactacgtggggatcccctggctcaac
tccacctgccaccactgcaccttttgcatgcaagctcaggagatgctttgcagcgaggcg
cagctctcggggtacacggtcgatggcagcttccagcagtacgctgtcgccaacgcctcg
catgtggccaagttccccaaggataaaggggttgagttggacgctgctgcgcccatcctg
tgtgccggtctgacggtctacactgggctcaagcagagcgaggcccggccggggcagtat
gtggccattgtgggcgcaggtggtggcttgggaagtttggcgacacagtacgccaaggcc
atgggcctacacgtcattgctattgacgggggtccggaaaagggggagagctgcaagaag
ttgggggccgaggtgtatgtggattatttgaagagcaaggacctggtggcggatgtcaag
gcggccacggcggatgggctgggaccgcatggggttttgctgctggccccgatggagaag
ccgtttcaacaggcgaccgggtatgtgagatctcatgggacggtggtttgtattggcatg
ccagcgggtgccaaggtgagcatgccggtgttcgacaccgtggtgaggatggtgcaggtg
aaggggtcttatgttgggaacagacaggatatggtggaggcgatagacttcttcctccgt
gggctggtgagggcaccggtcaaagtggtgggtatgagcgagctcggtggtgtgtttgat
gccatgagggagaacaaagtggtgggaaggtatgtactggataccagtcggtaa

DBGET integrated database retrieval system