KEGG   Podospora anserina: PODANSg3603Help
Entry
PODANSg3603       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
pan  Podospora anserina
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PODANSg3603
Enzymes [BR:pan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PODANSg3603
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PODANSg3603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 541 aa AA seqDB search
MKSFTRIAAGSLRQPRQSLPSTRHVCHSCQNLRLSRIGQRQFSQTAPSLTDSFGFKKYSL
PRSFKPKEINLPAKMASPPPPDPARKRLAYIALGSNLGDRIGWIEKACAELDARGIKVKR
TSSLWETEPMYVLDQDRFVNGACEVETTLEPLALLDALQDIENSLGRKKIIDKGPRNIDL
DILLYDNIKFNHERLTIPHIGIPEREFVLKPLAELIPDKPLDPDRPWTLTRDLLDALPSS
TTPITTMTPLSAHHPPIMALNPARKTHVMGILNMTPDSFSDGGQNTSLEEQTLISNIRSF
LDAGATMIDVGGQSTAPNCPEVSVEEELNRVLPAIKLIRSHFSDRPVLISVDTYRASVAE
AAVAAGADIVNDVSGGSMDPEMLPTVARLGTTICLMHMRGTPATMNNLAEYPDSEGGLIG
GIAKELVERVAAAETAGVRRWRIVLDPGLGFAKVGWQNVDVLRHLDELRFWPGLQGLPWL
VGSSRKSFIGRVTGVPTPKERIWGTAATVAAAVQGGADVVRVHDVREMAQVVAMADAIWR
Y
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcttcacacgtatcgccgcagggtcattgagacaaccccgacaaagtttacct
agtaccagacatgtatgccattcctgccagaacctgcgcctaagcaggattggacagcgg
caattttcccagacagcaccgtctctaacagattcgttcggcttcaaaaaatattctctc
ccgcgcagctttaagcccaaggaaataaacctgcctgccaagatggctagcccacctccc
ccagatccggcgcggaagcggctggcatatatcgccctgggaagcaacttgggggatcgt
attggctggatagaaaaggcctgcgccgagctggatgcgcggggcatcaaggtcaagcgc
acaagcagcctgtgggagacggagcccatgtatgtgctagaccaggatagattcgtcaat
ggtgcctgtgaggttgagacaactcttgagccacttgcccttctggatgctctccaagat
atcgagaactcccttggtcgcaaaaagatcattgacaagggcccgcgtaacattgacctc
gatatccttctctatgacaacatcaagttcaaccatgagcgcctcacaattcctcacatt
ggaatccccgaaagggagtttgtcttgaagcctcttgctgaacttatccccgacaaacct
ctggaccccgaccgaccatggaccctaacccgggacttacttgatgccctaccttcttct
actactcctatcaccactatgaccccgttgtcagcacaccacccccccatcatggctctc
aatccagcccggaaaacacacgtcatgggcatcctcaacatgacccctgactccttttct
gatggcggccaaaacacatcccttgaggagcaaactttgatctccaacatacgatccttc
ttggacgcaggcgccaccatgattgacgttggcgggcagtccaccgcccccaactgcccc
gaggtttcagtagaggaagagctcaaccgagtgctcccggctatcaagctcatccgctct
catttctcagataggccggtgctcattagtgtggacacctaccgagcatctgtcgccgag
gctgccgttgccgccggcgctgatattgtgaacgatgtctctggtggaagcatggacccg
gagatgttgcctactgttgcgaggttggggacaaccatctgtctgatgcacatgaggggg
acaccggcgacgatgaacaatcttgctgagtaccctgattctgaaggagggctcatcggc
gggattgctaaggaactggtggagagggtagcggctgccgagacggctggtgttagacgg
tggaggatcgtgcttgaccctgggttaggcttcgccaaggttggctggcaaaatgtcgat
gtgctgaggcacttggatgagctcaggttctggcctgggttgcaaggtctgccgtggctt
gtcgggtccagcaggaagagcttcattgggagggtgacaggcgtaccgacgccgaaggag
agaatatggggcacagccgcgacagttgcggctgctgttcagggaggagcggacgtggtg
agggtccatgatgtcagggagatggcgcaggtggtagcgatggcggatgctatctggcgg
tattga

DBGET integrated database retrieval system