KEGG   Podospora anserina: PODANSg3626Help
Entry
PODANSg3626       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pan  Podospora anserina
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PODANSg3626
Enzymes [BR:pan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PODANSg3626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 722 aa AA seqDB search
MRLRNLFVFGAAALATASPPSADTEEDITRENTYFNGKKVPPILELTPANYKEELKKSKF
LMVKHFSPWCGHCQEFLPTFQTLYEYYYTSKPVGKDADFTEFYDFRFAELNCVAYADLCT
ENKVAAWPTTILFEDGEPLVTFRGVKHISVLSGAVEDALEKVKPNTRPKTLELPEPGDKT
SPDSKAETEKTEKADAREKGSEKELVKETEKEKETETSTAASADASTEGEATPKKTYTVN
YNTPSQKVTPKPSNPNPKGLSVPLTWELFQSMVTLTQEPWFVKFYAPWCHHCQAMAPNWE
QLAKEMKGRLNIGEVNCDRDTRLCKELRVRGYPSIMFFKGGEKVEYEGLRGLGDFVQYAE
KAIDLSSGVPDVDFDSFKALEEKEEVIFLYFYDHATTSEDFLSLERYPLSLIGKAKLVKT
RDPKLYDRYKITTWPRLIVSREGRPTYYTPLAPREMRDTRMVLNWMKSVWLPLVPELTPS
NARDIMDGKIVVLGVLNRENEDSFRGAIREMKSAANEWMDKQIQLFQIHRQDLRDAKQLR
IEEAEDRGDQRALRNAKNIRINMDRSDMKEATFAWVDGNFWQRWIRTTYGIDAKDGDRVI
INDEDKRRYWDQTSTGNPIVPSRTSILETLNKVTVNPPKLKPKLTIGVIEKMFFDIKMTF
KEHPYLSMGCILGIAFGLFQWLMGRTTRRARSHFKLEEGVGMKESKPSTLFGGSSNTATK
AD
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaggctacgcaacctctttgtcttcggggcggccgcgctggcgaccgcctcaccacca
tcagccgacacggaggaggatatcacacgagaaaacacatacttcaatggcaagaaggtt
ccaccgattttggaactcaccccggccaattacaaggaggaattaaaaaagtcaaagttc
ctgatggtcaaacacttcagcccgtggtgcggacattgccaggaatttttgccgaccttc
cagacgttgtacgagtattactacacatcgaagccagtgggcaaggatgccgacttcacc
gagttctatgatttcagattcgctgaactcaactgcgtcgcgtacgccgatttatgtact
gagaacaaggtcgccgcatggccaacaactattttgtttgaggatggcgagcctttggtc
acctttaggggcgtcaagcacattagtgttctcagtggtgctgtcgaagatgcgctcgag
aaggtgaagcccaacaccaggcccaaaaccctcgagctccccgaacctggcgacaagaca
tcccctgattccaaggccgaaaccgagaagaccgagaaggcagatgccagggaaaagggg
tctgaaaaagagctggtcaaggaaactgagaaggagaaggagaccgaaacctccaccgcc
gccagcgccgatgcttcaacggaaggggaagcgacaccaaagaagacctacactgtcaac
tacaataccccttcgcagaaggtcacccctaagccgtcgaaccccaaccccaagggtctc
tccgttcctctgacttgggaattgttccaaagcatggttaccctcacccaggagccttgg
tttgtcaagttttatgcaccatggtgtcaccactgccaggctatggccccgaattgggag
cagttggccaaggaaatgaagggcaggctcaacattggtgaggtcaactgcgaccgcgac
actaggctttgcaaggaactccgcgtccgtggctatccttccatcatgttcttcaagggc
ggtgagaaggtcgagtacgagggccttcgcgggctgggcgactttgtccagtatgctgaa
aaggccattgatctctccagcggggttccggatgtcgatttcgactctttcaaggctctc
gaagagaaggaggaggtcattttcctctacttctacgatcatgctaccaccagcgaagac
ttcctttcgttggagcgttatcctctcagccttattggcaaagccaagttggtcaagacc
cgggatcccaagttgtatgatcgatacaagattaccacttggccacgtctgattgtttcg
cgcgagggccgcccgacttactacactcctctcgcgcctagggaaatgagggataccaga
atggttctcaactggatgaagtccgtctggctcccccttgttcccgagcttaccccgtcc
aacgcccgcgacatcatggacggcaagatcgttgttctgggggttctaaacagagagaat
gaggattctttccgtggcgctatccgtgagatgaagagtgcggccaacgagtggatggat
aagcagattcagctcttccagatccatcgccaggaccttcgtgacgccaagcagctccgc
atcgaggaggccgaggatcgtggtgaccagcgggctctgcgcaacgccaagaacattcgc
atcaacatggacaggtcggacatgaaagaggctacctttgcctgggttgacggcaacttc
tggcagcggtggattcgcaccacttatggcattgatgccaaggacggtgaccgtgttatc
atcaacgatgaagataaacgccggtattgggaccaaactagcactggaaaccccattgtt
ccctcgcgcacatccatccttgaaaccctcaacaaggtcacagtcaacccaccaaagctc
aagccgaagcttaccattggtgtgattgagaagatgttcttcgatatcaagatgaccttc
aaggagcatccctatctcagcatgggctgcatccttggcatcgcttttggtctcttccag
tggctcatgggaagaaccacaagaagagcccgcagtcactttaagctcgaggagggcgtt
ggaatgaaggaatcgaagccctccacgttgtttggcggatcaagcaacactgccaccaaa
gcggactag

DBGET integrated database retrieval system