KEGG   Podospora anserina: PODANSg3638Help
Entry
PODANSg3638       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PODANSg3638
Transcription machinery [BR:pan03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PODANSg3638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 466 aa AA seqDB search
MQATYLPTPRHSFPSSEQFQKKLSALTISSLSTGLLTPTSNTHNDYNFRNYMAPVSNKRT
NKMSNGKRDDSQEPLAARFAKRIKLSHDVPVTSSSVKLPAASLRIPFPEKPAVIEERNGE
IEFRVVNNDGSREHMIILTSLKCLFQKQLPKMPKDYIARLVYDRAHLSLAIIKRPLEVIG
GITFREFRQREFAEIVFCAVSSDQQVKGYGAHLMAHLKDYVKATSPVMHFLTYADNYATG
YFQKQGFSKEITLDKAIWMGYIKDYEGGTLMLCSLVPRIRYLEAGRMLLKQKETVQAKIR
SLSKSHVVHQPPAQWIVQSNSGAALTPIDPLSIPAIRATGWSPDMDALARLPRRGPHFKE
IRRFLYQIQNHKQAWPFLAPVNRDEVPDYYKIIANPMDLSTIEERLEHDAYATPKDFIAD
MKLIFSNCRKYNDATTVYAKCAAKLEKYMWGLVKEIPEWYELLEGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaacctacctaccgactccaaggcattctttcccatctagtgagcaatttcaa
aagaagctgtcggcactgacgataagttcactatcgactggtctccttaccccaacctcc
aacacccacaacgactacaatttccgcaattacatggcacccgtttcaaacaagagaacc
aacaagatgagcaatggaaagcgcgatgactcccaagaaccgcttgcggctcggttcgcc
aaaagaataaagctctcacacgatgtgccagtgacgagttcttcggtcaaactcccagct
gcctctttgaggattcctttccccgaaaagcctgcagttattgaggaacgaaacggtgaa
atcgaattccgcgtggtcaacaatgacggcagccgagagcacatgatcatattgacaagc
ctcaagtgcctgtttcaaaagcaacttccaaagatgcccaaggactacattgcccgcctc
gtctacgatcgcgcccatctgtcgctcgccatcatcaagagaccgttggaggtcataggc
gggataacctttcgagagttccgccagcgggagtttgccgagattgtgttttgtgccgtg
tcgtccgaccagcaggtcaaaggatatggagcccacctcatggcccatctcaaggactac
gtcaaggcaacctcgccagtgatgcatttcctcacatacgcggacaattacgcgacgggt
tactttcaaaagcagggcttttctaaggagatcaccctcgacaaggccatatggatgggt
tacatcaaggactacgagggagggacgctaatgctctgctcgttggtccctcgaattcga
tatctggaggccggtcgtatgcttctgaaacaaaaagaaaccgtgcaggccaagattagg
tctctgagcaaaagccatgtcgtccatcagccgcctgctcaatggatcgttcagagcaac
agcggcgccgctctcacccccatcgatcctctctccatcccagccattcgagccacaggc
tggtccccagacatggatgccttggcccgtctccctcgtcgcggacctcacttcaaggaa
ataagacgcttcctgtaccagatccaaaaccacaagcaggcgtggccttttctggccccc
gttaatagagatgaagttccggactattataagattatagccaacccgatggatctctct
acgatagaggagagactggaacacgatgcatacgcgacacctaaggatttcattgcggat
atgaagttgattttcagcaactgtcggaagtacaatgatgccacgacggtgtatgccaag
tgtgcggcgaagctggagaagtacatgtggggtctggtgaaggagatcccggagtggtat
gagctgcttgagggccaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system