KEGG   Podospora anserina: PODANSg3754Help
Entry
PODANSg3754       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
pan  Podospora anserina
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pan00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PODANSg3754
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PODANSg3754
Protein kinases [BR:pan01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PODANSg3754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 357 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYSDLQPVGMGAFGLVCSAKDQLTSANVAIKKIMKPFSTPVL
AKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVINT
IASENTLRFVKSLPKRERQPLKNKFKNADPAAIDLLEHMLVFDPKKRITATEALSHEYLA
PYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVEAGSVSMEGQFAGQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcgttcgtgctcagatttttgggaccaccttcgagattacctcgaggtac
tcggatctccaacctgttggaatgggtgcttttggacttgtttgctccgccaaagaccag
ctcaccagcgccaatgtcgccatcaagaagatcatgaagcccttcagcactcccgtactt
gccaagagaacataccgagagctcaagctgctgaagcacttgaagcacgaaaatgttatc
tccctcagtgacatcttcatctctccactggaagatatctacttcgtcaccgaattgctc
ggcaccgatctccatcgcctcctcacctctagacctcttgaaaagcagttcatccagtac
tttttgtaccagatcatgcgcggactgaaatacgtgcactcggccggcgttgtccatcgc
gatttgaagccaagcaacattctggtcaacgaaaactgcgatttgaagatttgcgacttc
ggtctggctcgcattcaagacccccagatgacgggttacgtttcgacgagatattaccgc
gcacccgagattatgctcacgtggcaaaagtatgatgttgaggtggatatttggagtgcc
ggttgcatcttcgctgagatgcttgagggcaagccccttttccctggaaaggaccatgtc
aaccagttctccatcattactgaactcttgggcacgccccccgatgatgttatcaacacc
atcgccagcgagaacaccctgagatttgtcaagtcccttcccaagcgcgaacgacaaccg
ctgaagaacaaattcaagaacgccgatcctgctgccatcgatcttttggagcacatgctc
gtgttcgatcccaagaagcggataacggccaccgaggcgttgtcgcacgaatacctggca
ccatatcacgatcctaccgatgagccagttgccgaggagaagttcgactggagcttcaac
gacgctgatttgccagttgacacatggaagataatgatgtactcggaaattctggactat
cacaacgtcgaggccggcagtgtttccatggagggtcaattcgcgggtcaatga

DBGET integrated database retrieval system