KEGG   Podospora anserina: PODANSg3754Help
Entry
PODANSg3754       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
pan  Podospora anserina
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pan04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 357 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYSDLQPVGMGAFGLVCSAKDQLTSANVAIKKIMKPFSTPVL
AKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVINT
IASENTLRFVKSLPKRERQPLKNKFKNADPAAIDLLEHMLVFDPKKRITATEALSHEYLA
PYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVEAGSVSMEGQFAGQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcgttcgtgctcagatttttgggaccaccttcgagattacctcgaggtac
tcggatctccaacctgttggaatgggtgcttttggacttgtttgctccgccaaagaccag
ctcaccagcgccaatgtcgccatcaagaagatcatgaagcccttcagcactcccgtactt
gccaagagaacataccgagagctcaagctgctgaagcacttgaagcacgaaaatgttatc
tccctcagtgacatcttcatctctccactggaagatatctacttcgtcaccgaattgctc
ggcaccgatctccatcgcctcctcacctctagacctcttgaaaagcagttcatccagtac
tttttgtaccagatcatgcgcggactgaaatacgtgcactcggccggcgttgtccatcgc
gatttgaagccaagcaacattctggtcaacgaaaactgcgatttgaagatttgcgacttc
ggtctggctcgcattcaagacccccagatgacgggttacgtttcgacgagatattaccgc
gcacccgagattatgctcacgtggcaaaagtatgatgttgaggtggatatttggagtgcc
ggttgcatcttcgctgagatgcttgagggcaagccccttttccctggaaaggaccatgtc
aaccagttctccatcattactgaactcttgggcacgccccccgatgatgttatcaacacc
atcgccagcgagaacaccctgagatttgtcaagtcccttcccaagcgcgaacgacaaccg
ctgaagaacaaattcaagaacgccgatcctgctgccatcgatcttttggagcacatgctc
gtgttcgatcccaagaagcggataacggccaccgaggcgttgtcgcacgaatacctggca
ccatatcacgatcctaccgatgagccagttgccgaggagaagttcgactggagcttcaac
gacgctgatttgccagttgacacatggaagataatgatgtactcggaaattctggactat
cacaacgtcgaggccggcagtgtttccatggagggtcaattcgcgggtcaatga

DBGET integrated database retrieval system