KEGG   Podospora anserina: PODANSg3804Help
Entry
PODANSg3804       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pan  Podospora anserina
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pan00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pan00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1007 aa AA seqDB search
AALVHEVSDETRFKKPIIADFEQLRNGVPAGMFTTPTEEPVWGIAHRVLTPAFGPVPIQE
MFPEMHELAAQLVMKWARHGPEQSIAVSEDFTRLALDTIALCSMNFRFNSYYHDELHPFI
TAMANFLTESGNRSLKGNFLSSLFFWSSNKYFADIKTLRDIAQSVLDARRANPNGKKDLL
SAMLDGVDRKTGEKLDDGAIIDNLITFLIAGHETTSGMLSFAFVMLLKNSETLKKARQEV
DEVIGRGPVTAEHMKKLPYITAILRETLRLCPTIPSYGVQALEDTVIGGKWAIAKGQVVL
LYLARSHRDKAVYGETADEFIPERMLDENFDRLSKEHPGFWKPFGNGQRGCIGRAFAWQE
AMVIMAMLVQNFDFEMSDPSYELKIKETLTTKPEGFEMKAKLRHGLTPTELERQLNGSLL
EKSTLSKHPHAQATEKGTQLKQLNIFYGSNTGTCEALAQRLAMDAPSHGYNATIIDALDA
AANRLPKDDATPVAFITASYEGEPPDNAIDFVTWIKDLPGTSSLKGTSYAVFGCGHRDWA
NTFHKVPRLVYNTLEQKGATPICDLGLTDVSQGEMFTDFEEWEDDVFWPAIKSKYGSAVG
GGRQQALEVQFSTPRASTLRQDVEEAVVVEEKTLTKGNGVPKKHLEVQLPEGMTYRAGDY
LAVLPVNPKESINRVMRKFGLAWDSHITVAGGAEGKKTTLPTGVPVPVHEVLGSYVELLQ
PVTKRGVQTLSNFTSAAADKAALSALSTNPELYTSTIITSRLSLLDILDRYPSISLPFGT
FLSLLPPMRVRQYSISSSPLASPSKATLTYTLLSGQSLANPANLFAGVATSYLSALRQGD
RLLVSVRQSHSSFHLPSNVETPVVMIAAGAGIAPFRGFIQERAALASQGNKLGKALLFFG
CRHPDWDDLYCDELGKWEADGIVKVTRAYSRQNDREYVGDSVLNYKDEVKQLWDNGARVY
VCGSRAVGDGVRSALGRVVLGDEAKEGEIAKWFEGVRNVRYAVDVFD
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
gcagccctcgtccatgaggtctccgatgaaacacgcttcaagaagcctatcattgctgac
ttcgagcaactccgcaatggcgttcccgccgggatgttcaccaccccgacagaagaacca
gtatggggtatcgcccaccgcgtcctaacccctgctttcgggccggtgcccatccaagag
atgtttcccgagatgcacgaattggctgcccagcttgtcatgaagtgggctcgccacggc
cccgagcaatccattgcggtcagtgaagacttcacccgacttgccctcgacaccattgcc
ctgtgttcgatgaatttccgattcaactcttactatcacgacgagctgcatcctttcatt
accgcaatggccaatttcttgaccgagtctggaaaccgatccctcaagggcaacttcttg
tccagtttatttttctggtcaagcaacaagtactttgctgacatcaagaccctgagggac
attgctcagtcagttctcgatgcccggagagcgaatccaaacggaaaaaaagacttgttg
tcggcaatgctggatggcgtggacaggaagacaggcgagaagttggatgatggggctatc
atcgacaacctcatcacctttttgatcgcaggccacgagaccacaagtggcatgttgagc
tttgcgtttgtgatgctgctcaagaactcagagacgctgaagaaggcccgccaggaggtc
gacgaggtgatcggtcgaggaccggttacggccgagcacatgaaaaagttgccatacatt
actgccattcttcgagagacgctcagactatgtccgaccattccttcgtacggcgttcag
gctctcgaagacacagttatcgggggcaaatgggcaatcgccaagggtcaggtcgttctt
ctctatctggcgagatcgcatcgagacaaagcggtctatggcgaaacagctgacgaattc
attcctgagaggatgctcgatgagaattttgatcggctcagcaaagaacatcccgggttt
tggaagccttttggaaatggtcagcgaggatgcatagggcgcgcgttcgcctggcaagaa
gccatggtcataatggcaatgctggtgcaaaactttgactttgagatgtcggatccgtcc
tacgagctcaagattaaagagactctgaccaccaaacctgagggattcgagatgaaagcc
aagctgaggcacgggttgacgcctaccgagctggagagacaactgaacggcagccttttg
gagaagagcacactttccaaacacccgcacgcccaagcgacagagaaggggacacagctc
aagcagctcaacattttttacggatccaacactggcacatgtgaggcgcttgcccagagg
ctggccatggacgccccttcccacggatacaatgcaacaatcattgatgcgcttgatgca
gcagcaaaccggctccccaaagatgacgccacccctgttgctttcatcactgcatcttac
gaaggagaaccgcctgataatgccatcgactttgtcacctggatcaaagacttgcctggc
acatcctccctcaaaggaacctcttatgccgtctttggctgtggccatcgcgactgggcc
aacaccttccacaaagtccctcgtctggtctacaacactcttgaacaaaagggagctacc
cctatttgcgatcttggtctgacagatgtttcccaaggtgagatgttcaccgactttgag
gaatgggaagatgacgtgttctggcctgccatcaagtcaaaatacggttctgctgtgggt
ggtggcaggcaacaggctcttgaggttcagttctcaacccctcgtgcttcgactttgagg
caagacgtcgaggaggctgtagtggtggaggaaaagactctgaccaagggaaatggggtt
ccaaaaaagcatctcgaagtccagcttccggaaggcatgacataccgcgctggggattat
ctggctgtgttgccggtgaatcccaaagagagtatcaaccgggtgatgagaaagtttggg
ttggcttgggatagccatatcacggttgccggtggggctgagggtaagaagacgacgctt
ccaactggagtaccagtgccagtccacgaggtgcttggctcttacgttgagctgttgcaa
cctgtcaccaagaggggcgtacaaacactttccaacttcacttcagctgcagccgacaaa
gcagcactgtctgctctttccacgaaccccgagctctacacttcgaccatcatcacctct
cggctatcattactggacattctcgacagatatccttccatctctcttcccttcggcaca
ttcctctcactcctccccccgatgagagtgaggcagtactcgatttcctcgtcccctttg
gcatcgccttccaaggctactctcacttacaccctcctctccggccagtcattggccaac
cccgccaatttgttcgcaggtgtcgctacgtcgtatctgtctgccctaaggcagggggat
agacttcttgtctctgtccggcaatcacactcgtcgttccacctaccctccaacgtcgag
accccggtggtgatgattgccgccggagcgggcatagcccccttccgtggtttcattcaa
gagcgggcggccttagcatctcagggtaataaactcggcaaagcgttgctcttctttggc
tgccggcaccccgactgggatgacctttattgtgacgagcttgggaagtgggaggctgat
ggcattgtgaaagtgacaagggcttatagcagacaaaatgaccgggaatacgtcggtgac
agtgttctgaactacaaagacgaagtgaagcagctgtgggacaatggtgcaagagtgtac
gtttgtggcagtcgggcagtcggagatggtgtgagaagtgccttggggagggttgttctt
ggtgacgaggcaaaggagggggagattgcaaagtggtttgagggggtgagaaatgtcagg
tatgcggtcgacgtttttgactag

DBGET integrated database retrieval system