KEGG   Podospora anserina: PODANSg3950Help
Entry
PODANSg3950       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pan  Podospora anserina
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1289 aa AA seqDB search
MYFTDKRHETTGKPKTPAFEIQDWRMRDRLKTVSAAIAVCLNIGVEPPDQLRTVPGAKLE
AWQDPTVPPTNKALENIGKALQTQYESIAFRTRYKQYLDPSIEETKKFCVSLRRNAKDER
ILFHYNGHGVPKPTTSGEIWVFNKNYTQYIPVSLYDLQQWLQAPTVFVWDCSEAGNILTN
YHKFVDKHEEEEKELRQKDPNCERQNYRPYIHLAACGTKENLPTNPQLPADLFTCCLTTP
VEMALWFFVLQNPLKTNLTPERARKLSGRLQERRTPLGELHWIFTAITDTIAWTTLPLAA
LFRAFLLAQRIMPVYGCHPQSYPELPDTRQHPLWDSWDLAVDMALAQLPMLERKELDGTP
YEYVNSTFFTEQLTAFEIYLCRGDAQSQKPPEQLPVVLQVLLSQQHRLRALILLTRFLDL
GPWAVQLALSIGIFPYVLKLLQSVAQDLKPVLVFIWARILAVDISCQQDLIKDNGYNYFA
DILKPQETILVNGTIVQTSHKAMCAFILAMLCKGFKPGQVVCNSTDIMKYCLHHVTHSED
PLLRQWSCLCISQLWRDLPEAKWRGIRENAHLKLAFLIKDPFPEVRAAMAHAMTTFLGIP
DLTDEVARIEEGIAWTMLELATDGSPIVRKELLVFFSKFVLRYENKFLVAAYEQLLEEKE
YMLHPPAEDGLDHKMGLHYARKENREVDGTIRPIAFGVAHDSIFAACWKHIDILSVDPHP
EVQRDATIILDYVHHALLHSPVGPQAQSLMDEILRRARKVSRGDMSQRSSVLGTHTAMAQ
PMPSPGLLKRTASYLFGPLLKENTPAGLTNPPLTPGLPKATNPGLSRTLSHRSRKGPSLE
NAPPEQNDQATSPANYHIANEPLCAGYRERSLTEVPKLPLESTFLDWSTEYFREPQMKLA
EAEEPGSHEYNERLWRRSRNEAVLRETQPQKAQAGTHKWNNQIGIINNGAQPAKMSFHQF
EDHVAVADDGNTVTVWDWKNGTRKSHFSNGNPEGSKISDMKFINEDDQALLMSGSSDGVI
RIYRNYDSDEGVELASSWRALTHMVPSNVNSGMVFDWQQVNGQVLVAGDERVIRIWNAGH
EMCSHEIPARSGSCVTSLTSDQMTGNIFIAGFGDGAIRVFDTRNRPQESMVRKWKDDSRQ
WVRSVHMQRGGQRELLSASRNGKVRLWDIRMENPLKVFQATKDVLRTASTHEHLPVFAVG
TSAHLVKVFDFDGHELSRLEPSTSFTAGLKLTPIATTAFHPHRMILGYAARGDNHIHISA
CGNEVAAPFVAAFAAEAAAKRLATIQQAV
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgtattttactgataaacgacatgagacaaccggcaagcccaaaacacccgctttcgag
atccaggattggcgaatgcgtgatcgtctcaagacggtgtccgcagccattgcagtatgt
ctcaatataggggttgagcctcctgatcagttgcgaaccgtgcctggtgcaaagcttgaa
gcttggcaagatccaactgttcccccaacaaacaaggccctggagaacattggcaaagcc
ctccaaacccagtatgagtcgatcgctttccggacccggtacaagcaatacctggaccct
tcgattgaagagacgaagaagttttgtgtttctctccggcggaatgccaaggacgagcgg
attctatttcattacaatggacacggagttcccaagccgacgacttctggtgaaatctgg
gttttcaacaaaaattacactcagtacattcctgtgtcactgtacgatctccagcaatgg
ctacaggcccccacggttttcgtctgggattgttcagaggcgggcaacattctgaccaac
taccacaagttcgtggacaaacatgaggaggaggagaaggagctgaggcagaaggatcca
aattgcgaaaggcagaactacaggccatatatccacctagctgcctgcggcacaaaggaa
aatctcccaacgaacccccagctaccggctgatcttttcacctgctgtctcaccacgcca
gttgagatggctctttggttttttgtgttgcaaaatccattaaagaccaatctgactcca
gagcgagctcgcaagttatcgggccgacttcaagagcgtaggactccgcttggggaactt
cactggatcttcacagctatcactgataccattgcgtggacgacccttcctctcgcggca
ctcttccgagcgtttctcctggcgcagcgcattatgcctgtgtatggctgtcatccgcag
tcatatcccgaactgccggatacccgtcaacatcctctctgggatagttgggatctcgcc
gttgacatggctctggcccagctcccaatgctggagaggaaggagctcgacggtactccc
tacgagtatgtcaactcgactttcttcacggagcagctcacggctttcgagatttacctc
tgtcgaggcgatgcacaatcccaaaagccacccgaacaactcccggtggtcctacaggtt
ttactaagccagcaacaccgacttagagccttgatcctacttactaggtttttggacctt
ggaccatgggccgttcagcttgcgctcagtatcggcatctttccttatgtcctgaaactg
ctccagtctgtcgcacaggatctcaaaccggtgctcgtcttcatctgggcgcgcatccta
gccgttgacatctcatgccagcaagacttgatcaaagataatgggtacaactactttgcc
gacattctgaagccccaagagacgattctggtcaacggcaccattgtccagacgtctcac
aaggccatgtgcgccttcatcttggctatgctttgcaagggtttcaagccgggtcaggtt
gtgtgcaattcgaccgacatcatgaaatactgcttgcaccatgtcactcattccgaagac
ccgctattgcggcagtggtcgtgtctctgcattagccagttatggagagatcttccagaa
gccaaatggcggggaatccgtgagaacgctcacctcaagctagcattcttaatcaaggac
ccattccccgaggttcgcgctgccatggcccatgccatgaccaccttccttggcattccc
gacctcacagatgaagtcgcaaggattgaggaaggcatcgcttggaccatgctcgaactg
gccacagacggcagtccgattgtccgcaaggaattgcttgttttcttctccaagttcgtg
ctgcggtacgaaaacaagttcttggttgctgcttatgagcaactgttggaggagaaggaa
tacatgctccacccaccagcggaggacggcttggatcacaagatgggcttgcattacgcc
agaaaggaaaatcgggaggtggatggcaccatcagacccattgcttttggtgtcgctcac
gactcgatttttgcagcctgctggaagcacatcgacatcctgagtgtcgacccgcaccct
gaagttcaaagggatgctaccattattctggactacgtccatcatgccctgctacactcc
cccgtggggccgcaggcgcagagtctcatggatgaaatcctcagacgcgctagaaaagtg
tcgaggggtgatatgagccagagaagcagcgtgcttggcacacacactgctatggcgcaa
cctatgccgtcccctgggcttctcaagagaacggcgagctatctgtttgggccgttactc
aaagagaacacgccggcgggactcacaaaccctcccctaactccaggactgccaaaggcc
acaaatccaggactgtccagaaccctttctcatagaagccgcaaaggacctagtctcgag
aatgccccgcccgagcaaaacgaccaggcgacttcgccagccaattatcatattgcgaac
gaaccgctttgcgcagggtatcgggagcgcagcttgactgaggtgcccaagcttcccctg
gagagcacattcttggactggtcgacggaatatttccgggaaccgcagatgaagctcgct
gaagccgaggagcccggcagtcacgagtacaatgaacgactctggcgtcgatctcgcaat
gaggctgttcttagagagacacagccccagaaagcacaggcgggaacccacaagtggaac
aaccagatcggtatcatcaacaatggtgcacagccggccaagatgtcgtttcatcaattc
gaggaccatgttgccgttgcagatgatggaaatacggtaacagtctgggattggaagaat
ggcacccgcaagagtcacttctccaatggcaaccctgaggggtcgaagatctcggacatg
aagttcatcaatgaagatgatcaggctcttctcatgagtgggtcttcggatggtgtcatt
cgcatctaccggaactacgacagtgatgaaggtgttgagcttgcctcttcatggcgtgcc
ttgacgcacatggtgccgtccaatgtcaactcaggcatggtctttgactggcagcaggtc
aatggccaggtcctcgtggcaggagacgagcgtgttatccggatatggaacgcaggccac
gagatgtgctcgcatgagatcccagcccgttccggatcttgtgttacatctttgacttct
gatcagatgacaggcaacatcttcattgctgggtttggagatggcgctattcgtgtcttt
gacacgagaaacagaccgcaggagagcatggtgcgcaagtggaaggatgacagcaggcag
tgggtgcgatcagtgcatatgcagcgtggcggacagcgcgagttgctgtcggcgagcagg
aatggcaaagtccggttatgggatattcgcatggagaatcctctgaaggtgttccaggct
acgaaggatgtgctcaggacggcaagcactcatgagcatttgcctgtgtttgctgttggc
acatccgcccacttggtcaaggtcttcgactttgacggccacgagctgtcgcgtctggaa
ccatcgactagcttcaccgccgggctcaagttaacacccatcgcgacaaccgctttccac
cctcaccgcatgatacttgggtacgccgcccgcggcgataaccacattcacatatccgcc
tgcggcaacgaggtcgcggcgccgtttgtggcagcatttgcggccgaggctgctgctaaa
cgccttgctactattcaacaggctgtttaa

DBGET integrated database retrieval system