KEGG   Podospora anserina: PODANSg4003Help
Entry
PODANSg4003       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pan  Podospora anserina
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pan04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 681 aa AA seqDB search
MADDNPRSDPVTPDEFAMSSPTSPASIDESSEASTPLDPPSSSSDAQPGFGSPSSDPPRR
VPSLRTVSDPQGSAHMNPTSSVAGILNNARRPPPSANSLPMDIMARARALQEQRMGMARA
NAGASPMGGMSLNMGGMGGSISGGPMGGPMGGPMGGPMSGALSGGLKLPGGMARPLPPGF
AKSAPAVPGTGPRKPLSLSERRAMKMGNISESGTPSPAGTPKLSDMNQGDGPKRPSLNGE
KHSSKLMDFKNYIDADKGWITFEGAATITRTGVNFAGGQTFSISLDEIDVMDELGKGNYG
TVYKVRHARPKAPRFGQGLSHFKPLSRQSSLSEEDASAESPLSPTSNSGRTTSGVVMAMK
EIRLELDEAKFTTILKELVILHECVSPYIIDFYGAFYQEGAVYMCIEYMDGGSIDKIYAG
GIPENVLRKITYATIMGLKSLKDDHNIIHRDVKPTNILVNTNGQVKICDFGVSGNLVASI
AKTNIGCQSYMAPERISGGAMAGAADGSYNVQSDIWSLGLTIIECAMGRYPYPPEISSTI
FSQLSAIVEGDPPDLPDEGYSASAKDFVRCCLNKIPAKRHTYAMLLQHPWIKALGKPETI
TEDAEAEDAAADDELADAAGAMSIATPSGHIGQGDYEVAEWVNSVLDRKKNGLLGDLANK
PALHAAPLDAVSPAGSPMTGA
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgacaacccccgatcggacccggtgactccagacgagtttgccatgagcagt
ccgacctcacccgcttccattgacgagtcctcggaagccagcacacctcttgaccccccc
agttcgagttctgatgcccagccgggctttggatcgccttccagcgacccaccccgccgt
gtaccctctctcagaacggtttccgatcctcagggcagcgcgcacatgaacccgacctcg
agtgtcgctggcattctcaacaatgctaggaggccgccaccaagtgccaacagcctgccc
atggacatcatggcaagagcacgcgcattacaagagcaacgcatgggtatggcccgggcc
aatgctggcgcttcccctatgggcggcatgagtctgaacatgggaggcatgggagggtca
atatcaggagggccgatgggagggccgatgggcggaccgatgggaggaccgatgtcgggt
gccttatcgggcgggctcaagctccccggtggcatggcccgaccattgccccctggcttt
gccaagtcagctccggctgtgccggggactggaccaaggaagcctctaagcttgagcgag
aggagggccatgaagatggggaatatatcagagtcagggaccccttcgccggccggtaca
cccaagctgtcggatatgaaccagggtgacgggccaaaacggccgtctttgaacggagaa
aagcacagctcgaagcttatggacttcaagaactacatcgacgcggataagggttggatc
accttcgaaggggcggcgacgattacccgcacgggtgtcaacttcgccggcgggcagacc
ttttccatctctttggacgaaatcgacgtcatggatgaactcggcaagggcaactacggc
actgtgtacaaggtgcgccatgcccgaccaaaagcaccacgctttgggcaaggcttgtcc
catttcaagccgctttcccgccaatcctctctgtccgaggaggacgcatccgccgagtcg
ccattaagtccaacctcaaatagcgggcggaccacctctggtgttgtcatggctatgaaa
gagatccgactcgagctggacgaagccaagtttacgaccattctcaaggagctggttatt
ctccacgagtgtgtttccccgtacatcatcgatttctatggtgccttctaccaagaaggt
gccgtctatatgtgtatcgaatatatggacggtggcagtatcgacaagatatatgctggc
ggtattcccgagaatgtcctgcggaaaattacctatgccacgattatgggtctcaaaagc
ctcaaggacgaccacaacatcatccatcgcgacgtcaagcctacaaatattctagtcaac
accaacggacaagtcaaaatttgcgatttcggtgtctcgggcaaccttgtggcaagtatc
gccaagaccaacattggctgccagagctacatggctccggaacgtatcagcggaggcgcg
atggccggtgctgcggatggctcgtacaatgtccagagtgatatctggagcttgggcttg
accattatcgagtgtgccatgggaagatacccctatccgcccgagatctcgagcaccatc
ttcagccagctcagtgccattgtggagggagatccgccagacctccccgacgagggctat
tccgcctctgccaaagactttgtccgctgctgtctcaacaagattcctgccaaacgtcac
acctacgccatgctcctccaacatccctggatcaaggccctcggcaagcccgagaccatc
acagaggacgccgaagccgaagatgcggccgcggatgacgaactggcggacgcagcgggt
gcgatgagcattgccaccccctcaggtcacataggacaaggggactatgaggtggccgag
tgggtgaatagtgttttggaccgcaagaagaacgggctgctgggtgatttggcaaacaag
ccggctttgcacgctgcaccgcttgatgcggtgagtcctgcgggcagtccaatgactggc
gcttga

DBGET integrated database retrieval system