KEGG   Podospora anserina: PODANSg4003Help
Entry
PODANSg4003       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pan  Podospora anserina
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pan00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PODANSg4003
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PODANSg4003
Protein kinases [BR:pan01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PODANSg4003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 681 aa AA seqDB search
MADDNPRSDPVTPDEFAMSSPTSPASIDESSEASTPLDPPSSSSDAQPGFGSPSSDPPRR
VPSLRTVSDPQGSAHMNPTSSVAGILNNARRPPPSANSLPMDIMARARALQEQRMGMARA
NAGASPMGGMSLNMGGMGGSISGGPMGGPMGGPMGGPMSGALSGGLKLPGGMARPLPPGF
AKSAPAVPGTGPRKPLSLSERRAMKMGNISESGTPSPAGTPKLSDMNQGDGPKRPSLNGE
KHSSKLMDFKNYIDADKGWITFEGAATITRTGVNFAGGQTFSISLDEIDVMDELGKGNYG
TVYKVRHARPKAPRFGQGLSHFKPLSRQSSLSEEDASAESPLSPTSNSGRTTSGVVMAMK
EIRLELDEAKFTTILKELVILHECVSPYIIDFYGAFYQEGAVYMCIEYMDGGSIDKIYAG
GIPENVLRKITYATIMGLKSLKDDHNIIHRDVKPTNILVNTNGQVKICDFGVSGNLVASI
AKTNIGCQSYMAPERISGGAMAGAADGSYNVQSDIWSLGLTIIECAMGRYPYPPEISSTI
FSQLSAIVEGDPPDLPDEGYSASAKDFVRCCLNKIPAKRHTYAMLLQHPWIKALGKPETI
TEDAEAEDAAADDELADAAGAMSIATPSGHIGQGDYEVAEWVNSVLDRKKNGLLGDLANK
PALHAAPLDAVSPAGSPMTGA
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgacaacccccgatcggacccggtgactccagacgagtttgccatgagcagt
ccgacctcacccgcttccattgacgagtcctcggaagccagcacacctcttgaccccccc
agttcgagttctgatgcccagccgggctttggatcgccttccagcgacccaccccgccgt
gtaccctctctcagaacggtttccgatcctcagggcagcgcgcacatgaacccgacctcg
agtgtcgctggcattctcaacaatgctaggaggccgccaccaagtgccaacagcctgccc
atggacatcatggcaagagcacgcgcattacaagagcaacgcatgggtatggcccgggcc
aatgctggcgcttcccctatgggcggcatgagtctgaacatgggaggcatgggagggtca
atatcaggagggccgatgggagggccgatgggcggaccgatgggaggaccgatgtcgggt
gccttatcgggcgggctcaagctccccggtggcatggcccgaccattgccccctggcttt
gccaagtcagctccggctgtgccggggactggaccaaggaagcctctaagcttgagcgag
aggagggccatgaagatggggaatatatcagagtcagggaccccttcgccggccggtaca
cccaagctgtcggatatgaaccagggtgacgggccaaaacggccgtctttgaacggagaa
aagcacagctcgaagcttatggacttcaagaactacatcgacgcggataagggttggatc
accttcgaaggggcggcgacgattacccgcacgggtgtcaacttcgccggcgggcagacc
ttttccatctctttggacgaaatcgacgtcatggatgaactcggcaagggcaactacggc
actgtgtacaaggtgcgccatgcccgaccaaaagcaccacgctttgggcaaggcttgtcc
catttcaagccgctttcccgccaatcctctctgtccgaggaggacgcatccgccgagtcg
ccattaagtccaacctcaaatagcgggcggaccacctctggtgttgtcatggctatgaaa
gagatccgactcgagctggacgaagccaagtttacgaccattctcaaggagctggttatt
ctccacgagtgtgtttccccgtacatcatcgatttctatggtgccttctaccaagaaggt
gccgtctatatgtgtatcgaatatatggacggtggcagtatcgacaagatatatgctggc
ggtattcccgagaatgtcctgcggaaaattacctatgccacgattatgggtctcaaaagc
ctcaaggacgaccacaacatcatccatcgcgacgtcaagcctacaaatattctagtcaac
accaacggacaagtcaaaatttgcgatttcggtgtctcgggcaaccttgtggcaagtatc
gccaagaccaacattggctgccagagctacatggctccggaacgtatcagcggaggcgcg
atggccggtgctgcggatggctcgtacaatgtccagagtgatatctggagcttgggcttg
accattatcgagtgtgccatgggaagatacccctatccgcccgagatctcgagcaccatc
ttcagccagctcagtgccattgtggagggagatccgccagacctccccgacgagggctat
tccgcctctgccaaagactttgtccgctgctgtctcaacaagattcctgccaaacgtcac
acctacgccatgctcctccaacatccctggatcaaggccctcggcaagcccgagaccatc
acagaggacgccgaagccgaagatgcggccgcggatgacgaactggcggacgcagcgggt
gcgatgagcattgccaccccctcaggtcacataggacaaggggactatgaggtggccgag
tgggtgaatagtgttttggaccgcaagaagaacgggctgctgggtgatttggcaaacaag
ccggctttgcacgctgcaccgcttgatgcggtgagtcctgcgggcagtccaatgactggc
gcttga

DBGET integrated database retrieval system