KEGG   Podospora anserina: PODANSg4119Help
Entry
PODANSg4119       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pan  Podospora anserina
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PODANSg4119
Enzymes [BR:pan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PODANSg4119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 377 aa AA seqDB search
MQDTVHSLVWLSIGFALVNVAHSLEAQNNFRYLAQTPLSTAPTFDNEDTPWGLTTYANIP
YLPCLSKRDSLKYDIAVLGAPFDTATTGRPGARFGPGAIRSGSSRIYADAAWSLYTGENV
FKSNVKIVDCGDVPMTRLDNTVALKQLETGHDIINARSPVSRDLSPVPRIINLGGDHTTT
LSALRAAYKKWGKLSVIHFDAHIDTWNPKVLGGDVSDYGAVNHGTFLHIAHEEGLITNSS
IHAGIRAPLAHPVKDMKNDRRCGFDFVTSRDLDRFGISGIIERLKSRVGDAKIYISVDID
VLDPAFAPATGTAEPGGWTSRELLTILDGLVGLKVVGADVVEVAPAYDGAGETTGVAAAE
VVHSLLYLMVKTPVAGE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacactgtccattccctggtgtggctgtccattggcttcgccctggtcaatgtc
gctcacagcttggaagcccagaataactttcgatacctcgcccaaacccccctatctacc
gcacccacgttcgacaacgaagacacaccatggggcttaacaacttatgccaacattcca
tatctgccctgtctctcaaagcgtgacagcctcaaatatgacatcgccgtcctcggtgca
ccatttgacactgcaacaaccggccgaccaggagcccgcttcggccccggagcaatcaga
tctggctcctcgcgcatttacgcagatgcagcatggagtttatacaccggggaaaacgtc
ttcaaaagcaacgtcaaaatcgtcgactgcggagacgtcccaatgaccagactggacaac
accgtcgcgctcaaacagctggaaaccggccacgatatcatcaatgcccgctctcctgtt
tctagggacctgtcccctgtcccgaggattatcaacttgggaggtgatcataccaccacg
ctgtctgcgttgagggcagcgtacaagaaatgggggaaactctctgttattcatttcgat
gctcatatcgatacttggaaccccaaggtgttgggtggtgatgtttctgactatggagcg
gtaaaccacggaaccttccttcacattgcccacgaggaggggctcattacaaactccagc
attcacgcaggcatccgggcacctcttgcccacccagtcaaagacatgaagaatgatcgc
cgttgcgggtttgattttgttacctccagggatcttgaccgttttggtatcagcgggatt
atcgagaggctgaaatccagggttggagacgcgaaaatctatatcagtgttgacattgat
gttctggatcctgcttttgctcctgcaacgggaactgctgagccgggtggttggacgtcg
agggagctactgactatccttgacggactggttgggctcaaagttgtgggtgctgatgtt
gtggaagttgcgccggcttatgatggtgctggtgagacaacgggcgtggcggctgctgag
gttgtgcattctcttctgtatttgatggtgaagaccccagttgcgggggagtga

DBGET integrated database retrieval system