KEGG   Podospora anserina: PODANSg4139Help
Entry
PODANSg4139       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pan  Podospora anserina
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:pan04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 941 aa AA seqDB search
MNDMATAASPTPVGGGSHLNALGRRTSARQALRRPTSTSLSSRPQLGRSESNPAVSASFS
GTTSRETRAHSQPQSNQQPITAALHDSSDDEEPVVPMKLSALTKALLNDGASEGVSRGGA
QSVVSGRAASPPQRPASRVTRRSTASVSASAAVEDSEAAVGEVRQTRRTARTSSVQRGVT
GRSSPPRETSPAPQPRKRVVRLSNTSAGNNAFNSSFNGSFESSVRRSLSGTTGRSKRQES
AEVVEKKSVQAPVPVEPEQQEVEQQLADINTPVVPVRTVRIAVGSSGSKGRSDSSSGHSK
SSRGYSDHDQELGEEPATVGRSVAVAPQSSMRIGRIGKMGGSFLSGPARRGRRRQSEEDG
QDHGEGDAFGSGQEPESQQPQYMGLGMEQPQSSFLASNYREFAAASGSPVSSRDPSRAAV
RRGTSASVSPPEVRELERSHLELDFKIPTPTPRVPSSLGKENQAPAAQKPNPVVISLLDD
TKEPAKPIQPLVSDIRANAPPSQRAASPDRKVLAQKSENTPRRAAPPPPPKMSVLDAATA
NAGASTTTQASKKRQVMLRVNGRTYTRIDCIGRGGSGKVYRVSAENGKMFALKRVSLESA
DENTVRGFKGEIDLLKRLHGVDRVIQLIDHELNLEKQLLSVLMEVGELDFNTLLKSRQSA
TEGARLDPVFIRYYWKEMLECVQAVHLKDVVHSDLKPANFVLVQGRLKLIDFGIANAIQT
EMTVNVHRETQIGTPNYMSPESLMDSNQYAFTSAHNGKFSIPPPLQHHQKGAPRIMKLGK
PSDVWSLGCILYQMVYGLPPFGKIANQMSRCQAIINWAYQVEFPEVTEDGSRVPPSLIRT
MRRCLNREQKERPTCEELLADTDPFLYPQEFDPGVYAMAEQGKVLPITEELLGRIIQSVV
QRCGERMPTPEEIKSGMLTQGYWAGVKRVVTGANSSGNSSR
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggccaccgccgcatcaccaacgccagttggcggagggagtcacctcaac
gctctgggacgtagaacatccgccagacaagcgctccgccgcccgacttcgacgtcgcta
tcttcgaggccgcagctcggccgtagcgagtccaaccctgctgtcagcgcatctttttct
ggcacaacttcgcgagagacgagggcgcattctcaacctcagtcaaaccagcaaccaatt
actgctgcgctgcatgacagctccgacgatgaggagccggtggtacctatgaagcttagc
gctttgacaaaggcattgcttaatgatggtgcgtccgagggagtgtccagggggggtgcg
cagtctgttgtctctggccgtgctgcttcaccgccgcaacgtcctgcttcgagggtgacg
aggaggtcgactgctagtgtttctgcttctgccgctgtggaggatagcgaggctgctgtg
ggggaggtgaggcagacgagacggacggcgaggacgagtagtgtccagcgtggggttacg
gggagatcttcacccccaagggagacgagccctgcgcctcagccacggaagcgcgttgtg
cgattgagcaatactagtgctgggaacaatgctttcaactcgagctttaatggtagcttt
gagtcgagtgtgaggaggtcattgtctggtactactggccggagcaagagacaggagagt
gccgaggtggttgagaagaagtcagttcaggctccggtgcccgttgagcctgagcagcag
gaggttgaacagcagcttgctgatatcaacacaccagttgtgcctgtgaggacggtacgc
attgccgtcgggtcatctggcagcaaggggaggtcggatagttcttccggtcactccaag
agctcccggggatatagcgatcatgatcaggagttgggtgaggaacccgcgactgttgga
cggtctgttgctgttgctcctcaaagttctatgcggattgggagaatagggaagatgggc
gggagctttctcagtggcccggctcgtcgtggaaggaggagacagagtgaggaggatgga
caggatcatggagagggtgatgcttttggcagtggtcaggagcctgaaagccaacagcct
cagtatatgggcctcggtatggagcagccacaatcatcattcttggcttccaactatcgc
gagtttgctgctgcttctggtagccctgttagctccagggatccctcaagagctgcggtc
cgcagagggacctcggctagcgtttctccgccagaggtcagggagcttgaaagaagccac
ctcgagttggacttcaagattcctacacccacaccacgtgttccttccagccttgggaag
gagaaccaagccccagcggcgcaaaagccaaacccagtggtgatctcccttttggatgac
accaaagagccggcgaagcccatccaaccacttgtaagcgacatcagagccaacgcacca
ccatcccaacgagcagcatcccctgaccgcaaggttctggcacagaaaagcgaaaacacc
ccccgccgcgccgcaccaccaccgcctccgaaaatgtcagtgcttgatgctgccacagcc
aacgccggtgcttctactactacacaggctagcaagaagaggcaggtcatgctccgagtc
aacggcaggacgtacaccagaatcgactgtataggccgtggcggttcgggtaaggtgtac
cgggtctctgcggagaacggcaagatgtttgccctcaagcgtgtctctcttgaaagtgcc
gatgagaacacggtgagaggattcaagggggagattgacctgctcaaaaggctgcacggc
gttgacagggtgattcagctgattgatcacgagttgaacctggagaagcagcttttgagt
gtgctcatggaggtgggcgagctcgattttaatactctgctgaaatcccgacagagcgcc
acggagggggcgaggttggatccggttttcatcaggtactactggaaggagatgctcgag
tgcgtgcaggctgttcatctcaaggatgtagtgcattcggatctcaaaccggccaacttt
gtgctcgtgcaggggaggctcaagctgattgactttgggattgcgaacgcgatccagacg
gagatgacggtcaacgtgcacagggagacgcagattgggacgccgaactacatgtcgccc
gagtcgctgatggactcgaaccagtatgcttttacgtcggcgcacaatggcaagttttcg
atcccgccgcctctgcagcatcaccaaaagggggctccgaggattatgaagctggggaag
ccgtcggatgtttggtcactagggtgtatcttgtatcagatggtttatggtctgccgcca
tttggcaagattgcgaaccagatgtcgaggtgtcaggcgattatcaattgggcgtatcag
gttgagtttcccgaggtcacggaggatgggagccgggtgccgccttcgctgattaggacg
atgaggaggtgcttgaaccgggagcagaaggagaggcctacttgtgaggagctgttggcg
gatacggacccgtttttgtatcctcaggagtttgaccctggtgtttatgccatggctgag
cagggcaaggtgctgcctattacggaggagttattggggaggattattcagagtgtggtg
caaaggtgtggggagaggatgccgacgccggaggagatcaagagtgggatgctcacgcag
gggtattgggctggggtgaaaagggtggttaccggtgctaatagcagtggtaattcctcg
aggtaa

DBGET integrated database retrieval system