KEGG   Podospora anserina: PODANSg4388Help
Entry
PODANSg4388       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
Organism
pan  Podospora anserina
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 412 aa AA seqDB search
MAATVAHSQQPLSPGGPASNGGGGGGGGGGGGASGGGGGLHPLMAAAAANAAKQQQQQSQ
QRINARDQEPFDLTSKKLSLADFSRVRTLGTGTFARVCLVRPSHGTEADRSKVYALKILR
KTEVIKLKQIDHVRHERQILSDVSGHPFITSFQASFSDHDFLYILLDYIPGGELFTYLRK
YRRFDEDMARFYAAEIVLVLEYLHEHQGGIAYRDMKPENLLLDAEGHIKLVDFGFAKRLG
NNENDHPEETYTLCGTPEYLAPEVIHNKGHTTAVDWWALGILIYEFLTGYPPFWHSNPIE
IYKQIVEKPVVFPQDPPISPEAKDIILQFCTVDRSRRLGNISGGAARVKAHPFFKGVDWD
AVLARKYKGPILPPVRYPGDAQCFDIYPEEDDRKEEYTGEMAEKYDEYFKDF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactgttgcgcattcacaacaacccctctcgcctgggggcccagcaagtaat
ggcggcggcggcggcggcggcggtggtggtggtggtgctagtggaggaggtggtggtctt
catcccttgatggcggccgcggcagccaatgccgcgaagcagcagcaacagcagtctcag
caaaggataaatgcccgcgatcaggagccgtttgatttaacgtccaagaagctaagtctg
gccgatttctcaagggtgagaacgttaggaacgggaacatttgcgcgcgtatgccttgtt
cggccatcgcacggtaccgaagccgatcgcagcaaagtctacgctctcaaaattctccgc
aagaccgaggtaataaagctaaagcaaatcgaccacgtccgccacgagcggcaaatcctc
tccgatgtctcaggccaccccttcatcacctccttccaggcctccttctccgaccatgac
tttctgtatatcctcctcgactacatccccggcggcgagctcttcacctacctccgcaaa
taccgccgtttcgacgaggacatggcccggttttatgctgctgaaatcgtcctcgtgctc
gaatacctgcacgaacaccaaggcggcatcgcctaccgggacatgaagccggaaaacctc
ctcctcgacgcagaaggccacatcaagctcgtagactttggctttgcgaaacggctgggc
aacaacgaaaacgatcatcccgaagagacgtacaccctctgcggcacaccagaatacctc
gctccagaagtgattcacaacaaggggcacaccacagcggtagactggtgggcgttgggg
attctaatctacgagttcctaactgggtacccaccgttctggcactcgaacccaatcgaa
atctacaaacaaattgtagaaaaaccggtcgtcttcccccaagacccacccatctcccca
gaagcaaaagacatcatcctccaattctgcacggttgatcgttctcgaaggttaggcaac
atcagcggcggcgctgccagggtaaaagctcacccttttttcaagggggtggactgggat
gcggtgctggcgaggaaatacaagggtccgatactgccaccggtgaggtacccgggggat
gcgcagtgttttgatatttacccggaggaggatgataggaaggaggagtataccggtgag
atggctgagaagtatgacgagtattttaaggatttttag

DBGET integrated database retrieval system