KEGG   Podospora anserina: PODANSg4427Help
Entry
PODANSg4427       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pan  Podospora anserina
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PODANSg4427
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PODANSg4427
   00630 Glyoxylate and dicarboxylate metabolism
    PODANSg4427
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PODANSg4427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 531 aa AA seqDB search
DNGALQTPHPPTSPHAHNITMPSTESILQGVNVLGPVSESQKKILTPEALAFLALLQRSF
NSTRKALLERRKIRQAKLDKGALPDFLPENKTHSREPNMEGRAPRSRACGRRWGNHGPHS
TDQVNLYDANRRQVDFKIGNKEYKLRTDKKLPTLIVRPRGWHLEEKHVTVDGEPMSGSLF
DFGLYFFHNAFQTVKMGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGMPRGTIRGTVLI
ETILAAFEMDEIIYELRDHSSGLNCGRWDYIFSVIKKFRQNSNFVLPDRSAVTMTVPFMD
AYVKLLIQTCHKRGVHAMGGMAAQIPIKDDPKANEVAMEGVRADKLREVKAGHDGTWVAH
PALAGIAVDIFNKHMPTPNQLFVRREDVTIGQNDLLNMNVPGQITEAGIRKNLNIGLGYM
EAWIRGVGCVPINYLMEDAATAEVSRSQLWQWVRHGVTTAEGKKVDKQYALKLLKEQTQE
LASKAPQGNKYGLAAQYFSGQVTGEDYADFLTSLLYNEITSAGPARAAAKL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gataacggagctttgcaaacaccacacccacccacatcaccccacgcacacaacatcaca
atgcctagcaccgagtccatccttcagggcgtcaacgtcctcggccccgtttcggagtca
caaaagaagatcctcacaccggaagctcttgctttcttggcccttctccagcggtcattc
aactctactcgcaaggctctccttgagcgccgcaagatccgccaggccaagctcgacaag
ggcgctctgcctgacttccttcccgaaaacaaaacacattcgcgagaaccaaacatggaa
ggccgcgccccccgctcccgggcttgtggacgccggtggggaaatcacgggccccactca
acggaccaggtcaacctctacgacgccaaccgccgccaggtcgacttcaagatcggcaac
aaggagtacaagctccgcactgataagaagctccccaccttgattgtccgcccccgtggc
tggcatctggaggagaagcacgttaccgtcgacggcgagcccatgtctggctctctcttc
gacttcggtctgtacttcttccacaatgccttccagaccgtcaagatgggcttcggccct
tacttctaccttcccaagatggagtctcaccttgaggcccgtctctggaacgatgtcttc
aaccttgctcaggactacatcggcatgcccagaggcaccatccgcggcaccgtcctcatc
gagaccatcctcgccgcctttgagatggacgagatcatctacgagctccgcgaccactct
tccggcttgaactgcggcaggtgggattacatcttctccgtgatcaagaagttccgtcaa
aactccaactttgtccttcccgatcggtcggccgtcaccatgaccgttcccttcatggac
gcctacgtcaagctcctcatccagacttgccacaagcgcggtgtccacgccatgggtggc
atggctgcccagattcccatcaaggacgaccccaaggccaacgaggtggctatggagggt
gtcagagcggacaagctccgcgaggtcaaggccggccacgacggcacctgggttgctcac
cctgcgctggcgggcatcgcggtggacatcttcaacaagcacatgcccactcccaaccag
ctgtttgtcagacgggaggatgtcacgattggtcagaatgacttgttgaacatgaacgtg
cctggtcagattaccgaggcgggtatcaggaagaacctgaacattggcctgggctacatg
gaggcttggattaggggtgttgggtgtgttcctattaactacttgatggaggacgccgcc
acagccgaggtttcccgttcccagctctggcagtgggtgcgccacggcgtcaccaccgcc
gagggcaagaaggtcgacaagcagtacgccctcaagctcctcaaggagcagacccaggag
ctcgccagcaaggctcctcagggcaacaagtatggtcttgcggcccagtacttttccggt
caggtcaccggtgaggactatgctgatttcttgacgagcctgctgtacaatgagatcacc
tctgctggtccggcgagagcggctgctaagttgtaa

DBGET integrated database retrieval system