KEGG   Podospora anserina: PODANSg455Help
Entry
PODANSg455        CDS       T01048                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pan  Podospora anserina
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PODANSg455
Translation factors [BR:pan03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PODANSg455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 280 aa AA seqDB search
MPGPNKRWDDEEEESSSGTEAPTTAAPVGRRKFDDEEAEDSDVLDSWDAAEDSEVEREKA
KKAAEAKAKAEAEAAANKKSKAQRIAERQAERARQLAEESESDGETEAQKRERLRRTEKE
ADLAHAQDLFGAIGISSGRKANASASVVQLPGSDPNNTIDLSTLPIFNPLTKGQFETLRN
ATAPLLASNAKKAHFVNFAQEYFKQIIKDCKSDEIKKVASALTALSNEKLKEEKAAEKGG
KKTKAAKTKTSLAGVSRGGGVAQDTATYDDDEAFGDDDFM
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaccaaacaagcggtgggacgatgaagaggaggagtctagctccggcaccgag
gccccaaccaccgctgcccccgtcggccgccgcaagttcgacgatgaggaggccgaggac
agcgatgtcctggactcctgggacgccgccgaggactccgaggtagagcgcgagaaggca
aagaaggctgccgaagccaaggccaaggccgaagccgaagccgctgccaacaagaagagc
aaggcccagcgcatcgccgagcgccaggccgagcgcgcccgccagctcgcggaggaatcc
gagagcgacggcgaaaccgaggcccagaagcgtgagcgtctccgtcgcaccgagaaggaa
gccgatcttgcccacgcccaggatctctttggcgccatcggcatcagcagcggccgcaag
gccaacgcctccgccagcgttgtccagctccccggaagcgaccccaacaacaccatcgat
ctctcgaccctgccaatcttcaacccactcaccaagggccagttcgagaccctccgcaac
gcgacagcccctctcctcgcctccaacgccaagaaggcccacttcgtcaactttgcccag
gagtacttcaagcagatcatcaaggactgcaagtctgacgagatcaagaaggtcgccagc
gccctgacagccctcagcaacgagaagctgaaggaggagaaggcggccgagaagggcggc
aagaagaccaaggctgccaagaccaagacctctctggcgggtgtgtcccgtggcggtggt
gttgctcaagataccgctacctacgatgatgatgaggcctttggagatgatgactttatg
tga

DBGET integrated database retrieval system