KEGG   Podospora anserina: PODANSg455Help
Entry
PODANSg455        CDS       T01048                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pan  Podospora anserina
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pan03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 280 aa AA seqDB search
MPGPNKRWDDEEEESSSGTEAPTTAAPVGRRKFDDEEAEDSDVLDSWDAAEDSEVEREKA
KKAAEAKAKAEAEAAANKKSKAQRIAERQAERARQLAEESESDGETEAQKRERLRRTEKE
ADLAHAQDLFGAIGISSGRKANASASVVQLPGSDPNNTIDLSTLPIFNPLTKGQFETLRN
ATAPLLASNAKKAHFVNFAQEYFKQIIKDCKSDEIKKVASALTALSNEKLKEEKAAEKGG
KKTKAAKTKTSLAGVSRGGGVAQDTATYDDDEAFGDDDFM
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaccaaacaagcggtgggacgatgaagaggaggagtctagctccggcaccgag
gccccaaccaccgctgcccccgtcggccgccgcaagttcgacgatgaggaggccgaggac
agcgatgtcctggactcctgggacgccgccgaggactccgaggtagagcgcgagaaggca
aagaaggctgccgaagccaaggccaaggccgaagccgaagccgctgccaacaagaagagc
aaggcccagcgcatcgccgagcgccaggccgagcgcgcccgccagctcgcggaggaatcc
gagagcgacggcgaaaccgaggcccagaagcgtgagcgtctccgtcgcaccgagaaggaa
gccgatcttgcccacgcccaggatctctttggcgccatcggcatcagcagcggccgcaag
gccaacgcctccgccagcgttgtccagctccccggaagcgaccccaacaacaccatcgat
ctctcgaccctgccaatcttcaacccactcaccaagggccagttcgagaccctccgcaac
gcgacagcccctctcctcgcctccaacgccaagaaggcccacttcgtcaactttgcccag
gagtacttcaagcagatcatcaaggactgcaagtctgacgagatcaagaaggtcgccagc
gccctgacagccctcagcaacgagaagctgaaggaggagaaggcggccgagaagggcggc
aagaagaccaaggctgccaagaccaagacctctctggcgggtgtgtcccgtggcggtggt
gttgctcaagataccgctacctacgatgatgatgaggcctttggagatgatgactttatg
tga

DBGET integrated database retrieval system