KEGG   Podospora anserina: PODANSg4605Help
Entry
PODANSg4605       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PODANSg4605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 368 aa AA seqDB search
MHLPTAASLLLSALPLAVATPTPGHGHKEKGLNTYAKEAGLKYFGAATDSPGFRERAGYE
AQYPKYDQIMWKSDEFGQTTPTNGQKWLFTEPQQGVFNYTEGNIVTSLAKKHGKYLRCHA
LVWHSQLAPWVEAKTDWTKDELRAVIVNHVTRVAKAWKGQCYAWDVVNEALEEDGSYRKS
VFYNVLGEEYIKLAFATAAKVDPKAKLYYNDYNLEWPHAKTEGTQRIVKMLQKAKIRIDG
VGLQAHLIAEQAPTLDQHIDAIKGFTKLGVEVALTELDIRLQVPANATNLAQQKEAYKNA
VGACVQVKGCIGVTIWDFYDPFSWVPYVFPGEGAPLLWFEDWSKHPAYYGVQEALKNGTK
KGKPGKWW
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcccgacagctgcctcgctcctcctctcagcactgcctctcgcagttgccacc
cctactcccggccacggccacaaggagaagggtctcaacacctacgccaaagaggccggt
ctgaagtactttggtgctgccaccgactcgcccggtttccgtgagcgggctggctatgag
gctcagtatcccaagtatgaccagatcatgtggaagtcggacgagttcggccagaccacg
cctaccaacggacaaaagtggctcttcaccgaaccacagcagggcgtcttcaactatacc
gagggcaacattgttacctccctcgcgaagaagcacggcaaatatctccgctgccacgcc
ctcgtctggcactctcagctcgccccctgggttgaggccaagaccgactggactaaggac
gagctccgcgctgttatcgtcaaccacgtcacgcgcgttgcgaaggcctggaagggtcag
tgctacgcttgggatgttgtgaacgaggcgctcgaggaggatgggagctaccgcaagtcc
gtcttctacaacgtcctgggcgaggagtacatcaagctcgctttcgcgaccgctgccaag
gtcgaccccaaggccaagctgtactacaacgattacaacttggagtggccccatgccaag
actgagggcacccagcgcattgtcaagatgctccagaaggccaagatcagaatcgacggt
gttggccttcaggctcacttgattgccgagcaggcccctactctcgaccagcacattgac
gccatcaagggcttcaccaagctcggcgttgaggttgcccttaccgagttggacattcgc
ctgcaggtgcccgccaacgccaccaaccttgctcagcagaaggaggcttacaagaacgct
gttggcgcttgcgtccaggtcaagggctgcatcggtgtcaccatctgggatttctatgac
cccttcagctgggtgccctatgttttccccggcgagggtgctcccctcctctggtttgag
gactggagcaagcaccccgcctactacggcgtgcaggaggctctcaagaacggcaccaag
aagggcaagcctggcaagtggtggtaa

DBGET integrated database retrieval system