KEGG   Podospora anserina: PODANSg4668Help
Entry
PODANSg4668       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
pan  Podospora anserina
Pathway
pan00061  Fatty acid biosynthesis
pan00254  Aflatoxin biosynthesis
pan00620  Pyruvate metabolism
pan00640  Propanoate metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01130  Biosynthesis of antibiotics
pan01212  Fatty acid metabolism
Module
pan_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PODANSg4668
   00640 Propanoate metabolism
    PODANSg4668
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PODANSg4668
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PODANSg4668
Enzymes [BR:pan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PODANSg4668
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PODANSg4668
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PODANSg4668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp_3 ATP-grasp GxGYxYP_N Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 6192324
NCBI-ProteinID: XP_001907634
UniProt: B2AV83
Position
7
AA seq 2286 aa AA seqDB search
MGDTPRNGVIVPKSNGKASYAEKHKIASHFIGGNRLENAPPSKVKDFVANHDGHTVITNV
LIANNGIAAVKEIRSVRKWAYETFGDERAIKFTVMATPEDLQANADYIRMADHYVEVPGG
TNNHNYANVELIVDIAERMDVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAMRS
LGDKISSTIVAQHADVPCIPWSGTGVSQVSVDEDGIVTVPDDVYLKGCVSSWQEGLEKAK
EIGFPVMVKASEGGGGKGIRKVVNEETFEELYKAAASEIPGSPIFVMKLADSARHLEVQL
LADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPNTFKAMEEAAVRLGKLVGYVSAGT
VEYLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGLPLHRIQDIRLLYG
VDPKTATEIDFQFANPESEKTQRRPTPKGHTTACRITSEDPGEGFKPSNGVLHDLNFRSS
SNVWGYFSVGSAGGIHSFSDSQFGHIFAYGENRAASRKHMVVALKELSIRGDFRTTVEYL
IKLLETEAFEDNTITTGWLDELISKKLTAERPDPMLAVVCGAVTKAHIASENCIAEYRAG
LEKGQVPSKDILKTVFPVDFIYEGYRYKFTVSRSSSDSYHLFINGSKCTVGVRALSDGGL
LVLLDGRSHNVYWKEEAAATRISVDSKTCLLEQENDPTQLRTPSPGKLVKYSVENGAHVR
AGQTFAEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKQAQSFIG
QLPEYGPPVVVGNKPAQKFTLLFNTLKNILMGFDNQVIMLQTLKGLIEVLRDPKLPYSEF
SAQFSALHARMPQKLDAQFSSVLERASSRGAEFPARNLAKVFQKFLDDNVTSKSDADVLK
TTLQPLTDVLDMYAEGQKVRELTVITELLNMYAEVERLFSGRRSQDEEVILQLRDQNKED
TSKVVQTVLSHTRVAAKNSLVLAILEEYRPNKPNVGNVGKYLRPVLRKMAELESRQTAKV
SLKAREILIQCALPSLEERTAQMEHILRSSVVESRYGETGWDHREPNLEVIKEVVDSKYT
VFDVLTLFFAHEDPWVSLAALEVYVRRAYRAYVLKKIEYHTDETETPSFVSWDFALRKIG
QTEFGLPLQSAAPSSPATPVDNTFKRIHSISDMSYLERKTQEEPTRKGVIVPCKYLEDAD
DLLSRALDTLPVMNGAKKKTPGLIPDLSGKRRPPPPPRLDSIDELSAVVNVAIRDAEGRS
DDEILKEILPLVHQFKDDLFARRVRRLTFICGRNDGSYPGYYTFRGPEYIEDDSIRHIEP
SLAFQLELARLSKFKIKPVFTENKNIHMYEGVGKGVETDRRFFTRAVIRPGRLRDEIPTA
EYLISEADRVINDIFDALEIIGTHNSDLNHMFINFTPVFQLQPQEVEQSLQGFLDRFGPR
AWRLRVAQVEIRIICTDPSTGMPYPLRVIITNTSGYVIQVEMYAERKSDKGDWVFYSTGG
TTKIGSMHLLPVSTPYPTKNWLQPKRYKAHLMGTQYVYDFPELFRQAIQNSWANAVKKVP
SMAEKQPPVGECIEFNELVLDDHDNLAEVSRDPGTNTCGMVGWLISARTPEYPKGRKFVV
VANDITFNIGSFGPKEDNFFYKCTELARKLGVPRIYLSANSGARLGLANELMPHFSVAWN
EEGKPEAGFKYLYLNDEAKKRFESTVLTEEVSEGGEKRHKIVTIIGAEDGLGVECLRGSG
LIAGATSRAYQDIFTCTLVTCRSVGIGAYLVRLGQRAVQIEGQPIILTGAPALNNLLGRE
VYTSNLQLGGTQIMYRNGVSHLTANDDFAGVSKIVEWMSFVPDKRNNPVPISLGIDTWDR
DVVFTPEQKKPYDVRWMIAGKQDEDGFQPGLFDKDSFVETLGGWARTVVVGRARLGGIPM
GVIGVETRSVENITPADPANPDSIEQVSNEAGGVWYPNSAFKTAQAINDFNYGEQLPLMI
LANWRGFSGGQRDMYNEVLKYGSYIVDALVKFEQPVFIYIPPFGELRGGSWVVVDPTINP
TAMEMYADVDARGGVLEPEGIIGIKYRKDKQLETMARLDPVYSGLKRQIADTSLSKEEID
EIKKKMTEREQELLPVYAQISLQFADLHDRAGRMKAKGVIREVLEWRNARRFFYWRVRRR
LNEEYILRRLASAAAVSGVHNKNAAAAAQARARHLSLLESWCGIAHFDKSDREVAIWYEE
NRKVVHEKVEHLKAEALQAEMRELVRLGSQSTEDAASNPAWKGIRDVLHTMPVQEREKML
QYLKQV
NT seq 6861 nt NT seq  +upstreamnt  +downstreamnt
atgggagacacaccacggaacggcgttatagtgcccaagtccaacggcaaggcttcgtat
gccgagaagcacaaaatcgcctcccacttcattggcggcaaccggctggaaaatgccccg
ccgtccaaggtgaaggactttgtcgctaaccacgacggtcacaccgtcattacaaatgta
ttgatcgccaacaacggtatcgccgccgtcaaggagatcagatcagtgcgaaaatgggcc
tacgagacgtttggcgacgagcgggccatcaagttcaccgtgatggccacgccagaagat
ttgcaagcaaacgccgactacatccgtatggctgaccattacgttgaggttcccggcggc
acaaacaaccacaactatgccaatgtcgagcttattgttgacattgcggagcgtatggac
gtacacgccgtgtgggcaggctggggtcacgcttcggaaaaccccaagcttccagagtcc
ctcgccgcgtcaccaaagaagattgtgttcatcggtcctccgggctctgccatgcgctcg
ctcggtgacaagatctcttccaccattgtagctcagcacgccgatgtgccatgtattcca
tggtctggtactggcgtttcccaagtgagtgtggacgaggatggcatcgtcacagttcca
gatgatgtctacctcaagggctgcgtgagctcgtggcaagagggcttggagaaggcgaag
gagattggtttcccagtaatggtcaaggcctctgagggtggtggtggtaagggtattcgc
aaggtcgtcaacgaggagaccttcgaggagctttacaaggcggcggcgagcgagatcccc
ggctctcccattttcgtcatgaagttggccgacagtgcgagacatttggaggttcaattg
cttgctgatcagtacggcaacaacatttcgctgtttggcagagattgctcggtccaacgc
agacatcaaaagattatcgaagaggcccccgtcaccattgccaagccaaacacgttcaag
gccatggaggaggctgccgttcgcctcggcaagcttgtcggttacgtttccgccggtacc
gtcgagtatttgtactcccatgccgatgacaagttctacttcttggagttgaaccctcgt
ctccaggtcgagcatcctacgaccgaaatggtcagcggtgttaacctccccgctgcccag
ctgcagatcgccatgggtctcccacttcaccggattcaggacatccgtttgctgtatggt
gtggatcccaagacggctaccgagatcgacttccagtttgcgaaccctgaaagtgaaaag
acccagcgtaggccaacgcccaagggccacaccacggcctgccgtatcacctccgaggat
cccggtgagggcttcaagccatccaacggtgtgctccacgacttgaacttccgctccagc
tccaacgtctggggttacttctctgtcggttccgctggtggtattcacagcttctccgac
tctcagttcggtcacattttcgcctacggcgagaaccgtgctgcctccagaaagcacatg
gttgtggccctgaaggagctgagcatccgtggtgacttccgtactactgtcgagtacctc
atcaagcttctcgagaccgaggctttcgaggacaacaccatcaccaccggctggcttgat
gagttgatttccaagaagctcactgccgagagacctgaccctatgctcgctgttgtctgc
ggtgctgtcaccaaggctcacattgccagcgagaactgcattgccgaatacagagccggt
ctagagaagggccaagtcccctccaaggacattctcaagactgtcttccctgtggacttc
atctatgagggctaccggtacaagttcaccgtcagtcgttccagctctgacagctaccac
ctcttcatcaacggttccaagtgcacagtcggtgttcgcgctctcagcgacggtggtctc
ctggtcctcctcgatgggcgcagtcacaacgtgtactggaaggaagaggccgccgccact
cgcatctcagtcgacagcaagacctgcctgctggagcaggagaacgatcccacccagctc
cgcacgccatctcccggtaagctcgtgaagtactctgtggagaacggtgcccacgtgcgc
gctggccagacctttgccgaagttgaggtcatgaagatgtacatgcccctcatcgcgcag
gaggacggtattgtgcagctcatcaagcagcccggagctaccctcgaggctggtgacatt
ctcggtatcttggctcttgatgaccccagccgcgtcaagcaagctcagtcgttcatcggc
cagcttcccgagtatggccctcctgtggtggttggtaacaagcccgcccagaagttcacc
cttctcttcaacaccctcaagaacatcctcatgggtttcgacaaccaggtgatcatgctg
cagaccctgaaggggcttattgaggtgctccgcgaccccaagctcccctacagcgagttc
tcggctcagttctctgctctccatgcccgcatgccccagaagctcgacgctcagttcagc
tctgttctcgaacgtgcgtcctcgcgtggcgccgagttccctgctcgcaacctggccaag
gtcttccagaagttccttgacgacaacgtcacctccaagagcgacgcggacgtcctcaag
accactcttcagcctttgaccgacgtgctcgacatgtatgccgaaggtcagaaggtgcgt
gagttgaccgttattactgagctcctgaacatgtacgccgaggtcgagcgccttttctct
ggccgccggtctcaggacgaggaagtcatcttgcagcttcgtgaccagaacaaggaggac
acctccaaggttgtgcagactgtgctgtcgcataccagagtcgcggccaagaactcgctg
gttctcgccattctggaggagtaccgtcccaacaagcccaatgttggcaacgttggcaag
taccttcgcccagtgcttcgcaagatggccgagctcgagtcccgccaaactgctaaggtc
tcgttgaaggctcgtgagattctcatccagtgtgctcttccgtctctcgaggagagaacc
gcccagatggagcacattttgcgctcctctgttgttgagtcccgctacggcgagaccggc
tgggaccaccgggagcctaaccttgaggtcatcaaggaggtcgtcgactccaagtacact
gtcttcgatgtcctgacattgttcttcgctcacgaggatccctgggtttctctggctgct
ttggaggtttacgtccgtcgcgcgtaccgtgcgtatgtcctgaagaagattgagtaccac
accgatgagaccgagacgccatccttcgtttcctgggactttgctctgcgcaagatcggc
cagaccgagttcgggctgcccttgcagtccgccgccccatcctctccggctacgccggtt
gataacaccttcaagcgtatccactccatcagcgacatgtcctacctcgagaggaagaca
caagaggagccgacccgtaagggtgtgatagtgccatgcaagtacctcgaggatgccgat
gacctcctctccagagctctcgacaccctcccggtgatgaatggcgccaagaagaagacc
cctggcctcattcctgacctcagcggcaagcgtcgcccgccccctcctcctcgtcttgac
agcatcgacgaactttcagccgttgtcaacgttgccatccgcgatgctgagggccgcagc
gatgatgagatcttgaaggagatcttgcccctggtccatcagttcaaggatgaccttttc
gcccgccgcgtccgtcgtctgaccttcatctgcggccgcaacgatggctcgtaccccggt
tactacaccttccgtggccccgagtacattgaggatgacagtattcgccacattgagcct
tctcttgccttccagctcgaattggctcgtctctccaagttcaagatcaagcccgtattc
accgaaaacaagaacatccacatgtacgagggtgttgggaagggtgttgagactgatagg
cgcttcttcactcgtgctgtcattcgccccggaagacttcgggatgagattcctaccgcc
gagtacttgatttcggaagccgaccgcgtgatcaacgatatttttgacgctctcgagatt
atcggcacacacaactcggatttgaaccatatgttcatcaactttactcccgtcttccag
cttcagcctcaggaagttgagcagtcgcttcagggcttcttggatcgcttcggtccccgc
gcttggcgtcttcgtgttgcccaggtcgagatccgcattatttgcactgatccctccacc
ggcatgccctaccctctgcgtgtgatcattaccaacacctctggctacgtcatccaggta
gagatgtatgccgagcgcaagtcggataagggcgactgggtcttctactctaccggtggc
accaccaagatcggatccatgcatctgctccccgtctcgaccccttaccccaccaagaac
tggctccagcccaagcggtacaaggctcacttgatgggcactcagtatgtgtatgatttc
cccgagcttttccgccaggccatccagaacagctgggccaatgctgtcaagaaggtcccc
tccatggccgagaagcagcccccggttggcgagtgcatcgagttcaacgagcttgtcttg
gatgaccatgacaacttggccgaggtttctcgcgacccaggcaccaacacctgcggtatg
gtcggttggctcatcagcgcccgcacccccgaataccccaagggccgcaagtttgttgtc
gtcgccaacgacatcaccttcaacattggttctttcgggcccaaggaagacaacttcttc
tacaagtgcacagagcttgctcgcaagttgggcgttccccgcatctacttgtcggccaat
tcgggtgctcgcttgggtctggccaacgagctgatgcctcacttcagcgtggcctggaac
gaggagggcaagcccgaggctggcttcaagtacctctacctcaacgatgaggccaagaag
aggttcgagagcactgtgctgaccgaggaggtctctgagggtggcgagaagcgtcacaag
atcgtcaccatcattggtgctgaagacggtttgggtgtcgagtgcttgcgtggttccggc
ctcatcgccggtgccactagcagagcctaccaggatatctttacttgcacgctcgtcacc
tgccgctcggttggtattggtgcctaccttgtccgccttggtcagcgtgctgtgcaaatt
gagggccagcccatcatcctgactggtgcccccgccctcaacaaccttttgggtcgtgag
gtctacacctctaacctccagcttggtggcactcagatcatgtaccgcaacggtgtgtct
cacttgaccgccaacgacgactttgctggtgtttccaagattgttgagtggatgtccttc
gttcccgataagcgcaacaaccctgtgcccatcagccttggcatcgacacctgggatcgt
gacgttgtcttcaccccagagcagaagaagccctatgatgtcaggtggatgattgccggc
aagcaggacgaggatggtttccagcctggtctgttcgacaaggattccttcgtggagacc
cttggcggctgggctcgcactgtcgtggttggtcgtgctcgtctcggcggcattcctatg
ggtgtcatcggtgtcgagacccgctctgtcgagaacatcacacccgccgaccctgccaac
cctgactcgatcgagcaagtcagcaacgaggccggtggtgtttggtaccccaactctgcc
tttaagactgctcaggccatcaacgacttcaactatggcgagcagcttcccctgatgatc
cttgccaactggcgtggattctctggtggccagcgcgacatgtacaacgaggtcctcaag
tacggctcgtacattgtcgatgctctcgtcaagttcgagcagccagtcttcatctacatt
ccaccattcggtgagcttcgtggcggttcgtgggtcgtcgtcgatcccaccatcaacccg
accgccatggagatgtacgccgatgtggacgcccgcggcggtgtcttggagcctgagggt
atcatcggtatcaagtaccgcaaggacaagcagcttgagaccatggcccgtctcgatccc
gtttactcgggccttaagaggcagatcgccgacacgtcgctttccaaggaggagatcgat
gagatcaagaagaagatgacggagcgcgagcaggagcttctgcctgtatatgctcagatc
agcttgcagtttgccgatcttcacgaccgcgccggccgcatgaaggccaagggtgtcatt
cgcgaggtgctcgagtggcgcaacgcccgccgcttcttttactggcgcgtgcgcagaaga
ttgaacgaggagtacatcctccgccgccttgcctcggcggctgcggtttcgggcgttcac
aacaagaatgcggcggcagctgcccaagcccgcgcccgtcacctctccctcctcgaatcc
tggtgcggtattgcccactttgacaagtctgatcgcgaggttgccatctggtacgaggaa
aaccgcaaggtggtgcacgagaaggttgagcacctcaaggccgaggctctgcaggccgag
atgcgcgagctcgtccgccttggtagccagtctacggaggatgctgccagcaaccctgcc
tggaagggtatccgcgatgtccttcacaccatgccggtacaagaacgggagaagatgctc
cagtatctcaagcaggtgtaa

DBGET integrated database retrieval system