KEGG   Podospora anserina: PODANSg4668Help
Entry
PODANSg4668       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pan  Podospora anserina
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pan01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pan00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pan00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:pan00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:pan00254]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 2286 aa AA seqDB search
MGDTPRNGVIVPKSNGKASYAEKHKIASHFIGGNRLENAPPSKVKDFVANHDGHTVITNV
LIANNGIAAVKEIRSVRKWAYETFGDERAIKFTVMATPEDLQANADYIRMADHYVEVPGG
TNNHNYANVELIVDIAERMDVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAMRS
LGDKISSTIVAQHADVPCIPWSGTGVSQVSVDEDGIVTVPDDVYLKGCVSSWQEGLEKAK
EIGFPVMVKASEGGGGKGIRKVVNEETFEELYKAAASEIPGSPIFVMKLADSARHLEVQL
LADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPNTFKAMEEAAVRLGKLVGYVSAGT
VEYLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGLPLHRIQDIRLLYG
VDPKTATEIDFQFANPESEKTQRRPTPKGHTTACRITSEDPGEGFKPSNGVLHDLNFRSS
SNVWGYFSVGSAGGIHSFSDSQFGHIFAYGENRAASRKHMVVALKELSIRGDFRTTVEYL
IKLLETEAFEDNTITTGWLDELISKKLTAERPDPMLAVVCGAVTKAHIASENCIAEYRAG
LEKGQVPSKDILKTVFPVDFIYEGYRYKFTVSRSSSDSYHLFINGSKCTVGVRALSDGGL
LVLLDGRSHNVYWKEEAAATRISVDSKTCLLEQENDPTQLRTPSPGKLVKYSVENGAHVR
AGQTFAEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKQAQSFIG
QLPEYGPPVVVGNKPAQKFTLLFNTLKNILMGFDNQVIMLQTLKGLIEVLRDPKLPYSEF
SAQFSALHARMPQKLDAQFSSVLERASSRGAEFPARNLAKVFQKFLDDNVTSKSDADVLK
TTLQPLTDVLDMYAEGQKVRELTVITELLNMYAEVERLFSGRRSQDEEVILQLRDQNKED
TSKVVQTVLSHTRVAAKNSLVLAILEEYRPNKPNVGNVGKYLRPVLRKMAELESRQTAKV
SLKAREILIQCALPSLEERTAQMEHILRSSVVESRYGETGWDHREPNLEVIKEVVDSKYT
VFDVLTLFFAHEDPWVSLAALEVYVRRAYRAYVLKKIEYHTDETETPSFVSWDFALRKIG
QTEFGLPLQSAAPSSPATPVDNTFKRIHSISDMSYLERKTQEEPTRKGVIVPCKYLEDAD
DLLSRALDTLPVMNGAKKKTPGLIPDLSGKRRPPPPPRLDSIDELSAVVNVAIRDAEGRS
DDEILKEILPLVHQFKDDLFARRVRRLTFICGRNDGSYPGYYTFRGPEYIEDDSIRHIEP
SLAFQLELARLSKFKIKPVFTENKNIHMYEGVGKGVETDRRFFTRAVIRPGRLRDEIPTA
EYLISEADRVINDIFDALEIIGTHNSDLNHMFINFTPVFQLQPQEVEQSLQGFLDRFGPR
AWRLRVAQVEIRIICTDPSTGMPYPLRVIITNTSGYVIQVEMYAERKSDKGDWVFYSTGG
TTKIGSMHLLPVSTPYPTKNWLQPKRYKAHLMGTQYVYDFPELFRQAIQNSWANAVKKVP
SMAEKQPPVGECIEFNELVLDDHDNLAEVSRDPGTNTCGMVGWLISARTPEYPKGRKFVV
VANDITFNIGSFGPKEDNFFYKCTELARKLGVPRIYLSANSGARLGLANELMPHFSVAWN
EEGKPEAGFKYLYLNDEAKKRFESTVLTEEVSEGGEKRHKIVTIIGAEDGLGVECLRGSG
LIAGATSRAYQDIFTCTLVTCRSVGIGAYLVRLGQRAVQIEGQPIILTGAPALNNLLGRE
VYTSNLQLGGTQIMYRNGVSHLTANDDFAGVSKIVEWMSFVPDKRNNPVPISLGIDTWDR
DVVFTPEQKKPYDVRWMIAGKQDEDGFQPGLFDKDSFVETLGGWARTVVVGRARLGGIPM
GVIGVETRSVENITPADPANPDSIEQVSNEAGGVWYPNSAFKTAQAINDFNYGEQLPLMI
LANWRGFSGGQRDMYNEVLKYGSYIVDALVKFEQPVFIYIPPFGELRGGSWVVVDPTINP
TAMEMYADVDARGGVLEPEGIIGIKYRKDKQLETMARLDPVYSGLKRQIADTSLSKEEID
EIKKKMTEREQELLPVYAQISLQFADLHDRAGRMKAKGVIREVLEWRNARRFFYWRVRRR
LNEEYILRRLASAAAVSGVHNKNAAAAAQARARHLSLLESWCGIAHFDKSDREVAIWYEE
NRKVVHEKVEHLKAEALQAEMRELVRLGSQSTEDAASNPAWKGIRDVLHTMPVQEREKML
QYLKQV
NT seq 6861 nt NT seq  +upstreamnt  +downstreamnt
atgggagacacaccacggaacggcgttatagtgcccaagtccaacggcaaggcttcgtat
gccgagaagcacaaaatcgcctcccacttcattggcggcaaccggctggaaaatgccccg
ccgtccaaggtgaaggactttgtcgctaaccacgacggtcacaccgtcattacaaatgta
ttgatcgccaacaacggtatcgccgccgtcaaggagatcagatcagtgcgaaaatgggcc
tacgagacgtttggcgacgagcgggccatcaagttcaccgtgatggccacgccagaagat
ttgcaagcaaacgccgactacatccgtatggctgaccattacgttgaggttcccggcggc
acaaacaaccacaactatgccaatgtcgagcttattgttgacattgcggagcgtatggac
gtacacgccgtgtgggcaggctggggtcacgcttcggaaaaccccaagcttccagagtcc
ctcgccgcgtcaccaaagaagattgtgttcatcggtcctccgggctctgccatgcgctcg
ctcggtgacaagatctcttccaccattgtagctcagcacgccgatgtgccatgtattcca
tggtctggtactggcgtttcccaagtgagtgtggacgaggatggcatcgtcacagttcca
gatgatgtctacctcaagggctgcgtgagctcgtggcaagagggcttggagaaggcgaag
gagattggtttcccagtaatggtcaaggcctctgagggtggtggtggtaagggtattcgc
aaggtcgtcaacgaggagaccttcgaggagctttacaaggcggcggcgagcgagatcccc
ggctctcccattttcgtcatgaagttggccgacagtgcgagacatttggaggttcaattg
cttgctgatcagtacggcaacaacatttcgctgtttggcagagattgctcggtccaacgc
agacatcaaaagattatcgaagaggcccccgtcaccattgccaagccaaacacgttcaag
gccatggaggaggctgccgttcgcctcggcaagcttgtcggttacgtttccgccggtacc
gtcgagtatttgtactcccatgccgatgacaagttctacttcttggagttgaaccctcgt
ctccaggtcgagcatcctacgaccgaaatggtcagcggtgttaacctccccgctgcccag
ctgcagatcgccatgggtctcccacttcaccggattcaggacatccgtttgctgtatggt
gtggatcccaagacggctaccgagatcgacttccagtttgcgaaccctgaaagtgaaaag
acccagcgtaggccaacgcccaagggccacaccacggcctgccgtatcacctccgaggat
cccggtgagggcttcaagccatccaacggtgtgctccacgacttgaacttccgctccagc
tccaacgtctggggttacttctctgtcggttccgctggtggtattcacagcttctccgac
tctcagttcggtcacattttcgcctacggcgagaaccgtgctgcctccagaaagcacatg
gttgtggccctgaaggagctgagcatccgtggtgacttccgtactactgtcgagtacctc
atcaagcttctcgagaccgaggctttcgaggacaacaccatcaccaccggctggcttgat
gagttgatttccaagaagctcactgccgagagacctgaccctatgctcgctgttgtctgc
ggtgctgtcaccaaggctcacattgccagcgagaactgcattgccgaatacagagccggt
ctagagaagggccaagtcccctccaaggacattctcaagactgtcttccctgtggacttc
atctatgagggctaccggtacaagttcaccgtcagtcgttccagctctgacagctaccac
ctcttcatcaacggttccaagtgcacagtcggtgttcgcgctctcagcgacggtggtctc
ctggtcctcctcgatgggcgcagtcacaacgtgtactggaaggaagaggccgccgccact
cgcatctcagtcgacagcaagacctgcctgctggagcaggagaacgatcccacccagctc
cgcacgccatctcccggtaagctcgtgaagtactctgtggagaacggtgcccacgtgcgc
gctggccagacctttgccgaagttgaggtcatgaagatgtacatgcccctcatcgcgcag
gaggacggtattgtgcagctcatcaagcagcccggagctaccctcgaggctggtgacatt
ctcggtatcttggctcttgatgaccccagccgcgtcaagcaagctcagtcgttcatcggc
cagcttcccgagtatggccctcctgtggtggttggtaacaagcccgcccagaagttcacc
cttctcttcaacaccctcaagaacatcctcatgggtttcgacaaccaggtgatcatgctg
cagaccctgaaggggcttattgaggtgctccgcgaccccaagctcccctacagcgagttc
tcggctcagttctctgctctccatgcccgcatgccccagaagctcgacgctcagttcagc
tctgttctcgaacgtgcgtcctcgcgtggcgccgagttccctgctcgcaacctggccaag
gtcttccagaagttccttgacgacaacgtcacctccaagagcgacgcggacgtcctcaag
accactcttcagcctttgaccgacgtgctcgacatgtatgccgaaggtcagaaggtgcgt
gagttgaccgttattactgagctcctgaacatgtacgccgaggtcgagcgccttttctct
ggccgccggtctcaggacgaggaagtcatcttgcagcttcgtgaccagaacaaggaggac
acctccaaggttgtgcagactgtgctgtcgcataccagagtcgcggccaagaactcgctg
gttctcgccattctggaggagtaccgtcccaacaagcccaatgttggcaacgttggcaag
taccttcgcccagtgcttcgcaagatggccgagctcgagtcccgccaaactgctaaggtc
tcgttgaaggctcgtgagattctcatccagtgtgctcttccgtctctcgaggagagaacc
gcccagatggagcacattttgcgctcctctgttgttgagtcccgctacggcgagaccggc
tgggaccaccgggagcctaaccttgaggtcatcaaggaggtcgtcgactccaagtacact
gtcttcgatgtcctgacattgttcttcgctcacgaggatccctgggtttctctggctgct
ttggaggtttacgtccgtcgcgcgtaccgtgcgtatgtcctgaagaagattgagtaccac
accgatgagaccgagacgccatccttcgtttcctgggactttgctctgcgcaagatcggc
cagaccgagttcgggctgcccttgcagtccgccgccccatcctctccggctacgccggtt
gataacaccttcaagcgtatccactccatcagcgacatgtcctacctcgagaggaagaca
caagaggagccgacccgtaagggtgtgatagtgccatgcaagtacctcgaggatgccgat
gacctcctctccagagctctcgacaccctcccggtgatgaatggcgccaagaagaagacc
cctggcctcattcctgacctcagcggcaagcgtcgcccgccccctcctcctcgtcttgac
agcatcgacgaactttcagccgttgtcaacgttgccatccgcgatgctgagggccgcagc
gatgatgagatcttgaaggagatcttgcccctggtccatcagttcaaggatgaccttttc
gcccgccgcgtccgtcgtctgaccttcatctgcggccgcaacgatggctcgtaccccggt
tactacaccttccgtggccccgagtacattgaggatgacagtattcgccacattgagcct
tctcttgccttccagctcgaattggctcgtctctccaagttcaagatcaagcccgtattc
accgaaaacaagaacatccacatgtacgagggtgttgggaagggtgttgagactgatagg
cgcttcttcactcgtgctgtcattcgccccggaagacttcgggatgagattcctaccgcc
gagtacttgatttcggaagccgaccgcgtgatcaacgatatttttgacgctctcgagatt
atcggcacacacaactcggatttgaaccatatgttcatcaactttactcccgtcttccag
cttcagcctcaggaagttgagcagtcgcttcagggcttcttggatcgcttcggtccccgc
gcttggcgtcttcgtgttgcccaggtcgagatccgcattatttgcactgatccctccacc
ggcatgccctaccctctgcgtgtgatcattaccaacacctctggctacgtcatccaggta
gagatgtatgccgagcgcaagtcggataagggcgactgggtcttctactctaccggtggc
accaccaagatcggatccatgcatctgctccccgtctcgaccccttaccccaccaagaac
tggctccagcccaagcggtacaaggctcacttgatgggcactcagtatgtgtatgatttc
cccgagcttttccgccaggccatccagaacagctgggccaatgctgtcaagaaggtcccc
tccatggccgagaagcagcccccggttggcgagtgcatcgagttcaacgagcttgtcttg
gatgaccatgacaacttggccgaggtttctcgcgacccaggcaccaacacctgcggtatg
gtcggttggctcatcagcgcccgcacccccgaataccccaagggccgcaagtttgttgtc
gtcgccaacgacatcaccttcaacattggttctttcgggcccaaggaagacaacttcttc
tacaagtgcacagagcttgctcgcaagttgggcgttccccgcatctacttgtcggccaat
tcgggtgctcgcttgggtctggccaacgagctgatgcctcacttcagcgtggcctggaac
gaggagggcaagcccgaggctggcttcaagtacctctacctcaacgatgaggccaagaag
aggttcgagagcactgtgctgaccgaggaggtctctgagggtggcgagaagcgtcacaag
atcgtcaccatcattggtgctgaagacggtttgggtgtcgagtgcttgcgtggttccggc
ctcatcgccggtgccactagcagagcctaccaggatatctttacttgcacgctcgtcacc
tgccgctcggttggtattggtgcctaccttgtccgccttggtcagcgtgctgtgcaaatt
gagggccagcccatcatcctgactggtgcccccgccctcaacaaccttttgggtcgtgag
gtctacacctctaacctccagcttggtggcactcagatcatgtaccgcaacggtgtgtct
cacttgaccgccaacgacgactttgctggtgtttccaagattgttgagtggatgtccttc
gttcccgataagcgcaacaaccctgtgcccatcagccttggcatcgacacctgggatcgt
gacgttgtcttcaccccagagcagaagaagccctatgatgtcaggtggatgattgccggc
aagcaggacgaggatggtttccagcctggtctgttcgacaaggattccttcgtggagacc
cttggcggctgggctcgcactgtcgtggttggtcgtgctcgtctcggcggcattcctatg
ggtgtcatcggtgtcgagacccgctctgtcgagaacatcacacccgccgaccctgccaac
cctgactcgatcgagcaagtcagcaacgaggccggtggtgtttggtaccccaactctgcc
tttaagactgctcaggccatcaacgacttcaactatggcgagcagcttcccctgatgatc
cttgccaactggcgtggattctctggtggccagcgcgacatgtacaacgaggtcctcaag
tacggctcgtacattgtcgatgctctcgtcaagttcgagcagccagtcttcatctacatt
ccaccattcggtgagcttcgtggcggttcgtgggtcgtcgtcgatcccaccatcaacccg
accgccatggagatgtacgccgatgtggacgcccgcggcggtgtcttggagcctgagggt
atcatcggtatcaagtaccgcaaggacaagcagcttgagaccatggcccgtctcgatccc
gtttactcgggccttaagaggcagatcgccgacacgtcgctttccaaggaggagatcgat
gagatcaagaagaagatgacggagcgcgagcaggagcttctgcctgtatatgctcagatc
agcttgcagtttgccgatcttcacgaccgcgccggccgcatgaaggccaagggtgtcatt
cgcgaggtgctcgagtggcgcaacgcccgccgcttcttttactggcgcgtgcgcagaaga
ttgaacgaggagtacatcctccgccgccttgcctcggcggctgcggtttcgggcgttcac
aacaagaatgcggcggcagctgcccaagcccgcgcccgtcacctctccctcctcgaatcc
tggtgcggtattgcccactttgacaagtctgatcgcgaggttgccatctggtacgaggaa
aaccgcaaggtggtgcacgagaaggttgagcacctcaaggccgaggctctgcaggccgag
atgcgcgagctcgtccgccttggtagccagtctacggaggatgctgccagcaaccctgcc
tggaagggtatccgcgatgtccttcacaccatgccggtacaagaacgggagaagatgctc
cagtatctcaagcaggtgtaa

DBGET integrated database retrieval system