KEGG   Podospora anserina: PODANSg4777Help
Entry
PODANSg4777       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PODANSg4777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 685 aa AA seqDB search
MSTPTTATATLPPYSHSHFHYPHHHQQHKSFPQPNTSAYRSTNPVLPPASRLVYPSTSGY
NTHPATHAASNGASLMPLEPSRHHPHDSADLASHRSESLYSTMPANSQSSRTQVVTNPPP
SSSKKRQRDVDWNDFYKNGLPTEIIVIDDSPEPEEPATSKNLTNGHSYASGPTDASVAPP
AKRRRKETDAAPYDPVHHIASHTHTPRQYGSPSKSTTSSGRTNSANHTTAATSLGSLSSN
GQYDHELQQASQGQKRKRTRAQTNSEAKRREALVTDAFASYIPPRQPIKKSRDVPVQIIT
DTSRVDDDEGHYIVVPDNPLTERCKLLLNYDERLGILLTRIWNRSDGQAAWTRHVRQSRP
SQGQAASREVGRHQDHSLGAKVPRSQCIHLRDCFDYRGHICIVMDLLGQSVFDFLKSNNF
VPFPNSQIQSFALLHDLNLIHTDLKPENILLCHNEYQTFTYNRKIPSSSSNVARQATQRR
VLLDTEIRLIDFGSATFQDEYHSSVVSTRHYRAPEIILGLGWSFPCDIWSIGCILVEFFT
GDALFQTHDNLEHLAMMQAVVDANIDTHLVQSVNRQPRNGTNPASRYFKRNKLDYPTADT
TRQSKRFVRAMKTLPEIIPPNNKFLKEFLALLQKIFVYDPAKRITAKEALSHPWFQEHAY
PDDGTEAARIRAEKQRLNELSAIAP
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactccgactactgcaactgcgacgctccctccctacagtcacagtcactttcac
tacccacaccaccaccagcagcataaatcgttcccacaaccaaatacctctgcctaccgc
tctacgaacccggtgcttcctcctgcctcccgtctcgtttatccctctacctccggctac
aacactcacccggcgacacacgccgcgtcaaatggagcgagtctgatgcccctggagcca
tcgagacaccacccacacgactcggccgacttggcctcccatcgctcggaatcgctctac
tcaaccatgccggcaaactcgcagtcaagccgaacccaagtggtgaccaacccgccgccg
tcgtcgtcaaaaaagagacagagagatgtcgattggaatgatttctacaaaaatggcctg
ccgaccgaaatcatcgtcattgatgactcccccgagcccgaggagccggcaacgtccaag
aacctgaccaacggacattcctatgccagcggcccgaccgatgcttcggtcgcccctccg
gccaagaggaggagaaaagagactgatgcggcgccttacgaccctgttcaccatatcgca
tcacacacccacactcctcgccagtatgggtcgccaagcaaatcgacaacgtcaagtggc
cgtaccaactctgccaatcataccacggccgctacctcacttggctcactttcatcaaac
ggtcagtatgaccacgagttgcagcaggcgagccagggccagaagcggaaaagaacccgg
gcgcagacgaacagcgaggcgaagcgtcgcgaggctctggtcacagatgcttttgccagc
tacattcctcctcggcagcccatcaagaagtcccgagatgtcccggtccagatcatcact
gatacctcgcgggtcgacgatgacgaaggtcactacattgttgtgccggacaatcccttg
actgagcgatgtaagttgttgctcaattatgatgaacgcctcggcatcctgttgacgcga
atctggaacagatcagatggtcaagctgcttggacaaggcacgttcggcaaagtcgtcca
agccaaggacaggcagcgtccagggaagttggtcgccatcaagatcattcgctcggtgca
aaagtaccgcgaagccagtgcattcacctccgagactgcttcgattaccgcggccacatt
tgcatcgttatggacctgttgggtcagagcgtgttcgactttcttaagagcaataatttc
gtcccctttcccaacagccagattcagagcttcgccctcttgcatgatctcaacttgatc
cacacggatttgaagcccgagaatatcttgctttgtcataacgagtaccagacgttcacg
tacaaccgcaagattccatcctcgagcagcaatgttgcccgccaggccacacaaagaaga
gtattgttggacaccgagatccggttgattgactttgggtctgcaacatttcaggacgaa
tatcactcgtccgttgtgtcaactcggcattaccgtgcacccgaaatcattcttggtctt
ggctggtctttcccctgcgacatttggagcattggatgcattctcgtcgagttcttcacc
ggagatgcccttttccagacacacgataacctcgagcatctggccatgatgcaggcggtg
gtggacgccaatatcgacactcaccttgtccagtctgtaaaccgccagccacgcaatggc
accaacccagcatccaggtactttaagcggaacaagcttgattacccgacagcagatacc
acaagacagtcgaagagatttgtcagagcaatgaagacacttccggagatcattccgccg
aacaacaagttcctgaaagagttcttggcccttttacaaaagatctttgtctatgaccct
gccaaacggataacggccaaggaggctctgagccatccctggttccaggaacacgcttac
cccgacgacggaaccgaagctgctcgcattcgcgccgaaaagcagagactcaacgaactg
tcggccattgcgccatga

DBGET integrated database retrieval system