KEGG   Podospora anserina: PODANSg4842Help
Entry
PODANSg4842       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PODANSg4842
    1.3.1.94  polyprenol reductase
     PODANSg4842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 322 aa AA seqDB search
MSTTATTTSKMISQTISTLYSILSTIPPSQYCQSFFLFAAAAVSAIAVLPSDLKQILVDY
GARASSPKPSNNAVLSWLSTLTKHTQVPHSWFAIFYVVSVAWSVFWLGQFLSGGQVIKFI
AEQEMEYGGNGKGMGSVQVLAGWAMMFLQGARRTCEHLFVVRASSTSTMWVVHWVLGLGF
YLGVGVGVGVGGADAILNRRTLELSREEMVKLGVAVPVFFYAWVNQYKSHKHLAGLKKYS
LPTEGLFRWFVCAHYTCECLLYLSMAVATAPEGVWFNRTLVCALAFVVVNLGVTASGTRR
WYEEKFGKGAVEGRWNMIPFVF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaacagcgacaacaacaagcaaaatgatatcccaaaccatctccaccctctac
agcatcctttcaacaatacccccatctcagtactgccaatccttcttcctcttcgccgca
gcagccgtctcggcgattgcagtcctcccttcagacctcaagcaaatcctcgtcgactat
ggcgcccgggcatcttcaccaaaacccagcaacaacgccgtgttgtcatggctgtcaacc
ctgacgaaacacacccaggtcccgcactcgtggtttgcaatcttttacgttgtgtcagtg
gcctggtcggtgttttggctggggcagttcctctccggtggacaggtcatcaagttcatt
gcagagcaagaaatggaatatggagggaacgggaaagggatggggtcggtgcaagtgctg
gccgggtgggcgatgatgttcctccagggggcgaggaggacgtgcgaacacttgtttgtg
gtgagggcttcgagcacgtcgacgatgtgggttgttcactgggtgcttgggttggggttt
tacttgggggttggggtgggggttggggttgggggggcggatgctatcttgaatcggcga
acattagagttgagcagggaggagatggttaagcttggtgttgcggtcccggtgttcttc
tacgcctgggtcaaccagtacaaatctcacaaacatttggctggactgaagaaatattca
ctgcctactgagggactgttcagatggttcgtctgcgctcattacacttgcgagtgtttg
ctgtacttgtctatggctgtggctacggctccggagggggtttggttcaacaggacgctg
gtgtgcgcgttggcttttgtggtggttaaccttggcgttacagcttctggaacgaggagg
tggtatgaagaaaagtttgggaaaggggcggtggaggggaggtggaatatgattccgttt
gtgttttaa

DBGET integrated database retrieval system