KEGG   Podospora anserina: PODANSg4990Help
Entry
PODANSg4990       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pan  Podospora anserina
Pathway
pan00600  Sphingolipid metabolism
pan01100  Metabolic pathways
Module
pan_M00094  Ceramide biosynthesis
pan_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PODANSg4990
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PODANSg4990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 6191998
NCBI-ProteinID: XP_001907955
UniProt: B2AW54
Position
7
AA seq 425 aa AA seqDB search
METGSEPFPPLPGTTTTTESATATRRRTRKASILGDDLKVGDTGSPSLATSIAHIQAAHS
NEPPSPPSTKRTSKRRKARTLLRRVKHTCVKHTWVLPLFLLSCFLLGYAINPTSSNPLSH
FLFLSYRLPLSETPGATHVQYGKGLWDIAFVTFYTVVLSFTREFIMQEVLRPLSRWVGLK
SRGKQARYMEQMYTALYFGIMGPCGMWVMSRTPIWYFDVVGMYEGYPHKTHDGAFKFYYL
FQAAYWAQQAIVLLLGMEKPRKDFKELVGHHIVSLALIGLSYRFHFTYMGLAVYITHDIS
DFFLATSKSLNYVDHPITGPYYFLFMCSWIYLRHFLNLKILVSLFNEFKTVGPYVMDWEG
GSYKCDLAFWITGGLLGSLQALNLFWLFFIVRIAYRFVRDREASDDRSEDEGSGDEGEQQ
NGKKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggagacgggatcagagcccttcccgcctctgcccggcaccaccaccaccaccgagagc
gcgacggcgacgcgaaggaggacgagaaaggcgagcatcttgggagatgacttgaaagtg
ggcgacaccggctcgccgtcgcttgctacgagcattgcgcacatccaggcagcccactcc
aatgaacccccctcccccccatcaacaaaacgcacctccaaacgccgcaaagcccgcacc
ctcctccgccgagtcaagcacacgtgcgtaaaacacacttgggtcctccccttgttcctg
ttgtcttgcttcctcctcggctacgcaatcaaccctacctcctccaaccccctctcccac
tttttgttcctgtcgtacagactccccctgtcggaaaccccgggggcgacccacgtccag
tacggcaaggggctctgggacatcgcctttgtgaccttttacaccgtcgtcctctccttc
acgcgcgagttcatcatgcaggaggtcctccgcccgctctcccgctgggtcgggctcaag
tcgagggggaagcaggcgagatacatggagcagatgtacacggcgctctactttggcatc
atgggcccgtgtggcatgtgggtcatgtcgaggacgccaatctggtactttgatgtcgtg
gggatgtacgaaggttacccgcacaagacgcacgacggggcgtttaaattttattatctc
ttccaggcggcgtactgggcccagcaggcgattgtgttgttgcttgggatggagaagcca
cgaaaggactttaaggagctagtcggccaccatatcgtctcgcttgcgctcatcggtctg
agctacaggtttcactttacgtatatggggcttgcggtgtacatcacgcacgacatttcg
gactttttcctcgccacttccaaatcgctgaattatgtcgaccatccgatcacgggaccg
tactatttcttgtttatgtgctcttggatctacctgaggcattttttgaacttgaagatc
ttggttagcttgtttaatgagttcaagactgtcgggccgtatgtcatggactgggagggg
ggcagctacaagtgtgacttggcgttttggatcacggggggtttgctggggagcttgcag
gcgctgaatctgttttggttgtttttcattgtgaggattgcgtataggtttgtgagggat
cgggaggcgagtgatgataggagtgaggatgaggggagtggggatgagggggagcagcag
aacgggaagaagaagtga

DBGET integrated database retrieval system