KEGG   Podospora anserina: PODANSg4990Help
Entry
PODANSg4990       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pan  Podospora anserina
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PODANSg4990
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PODANSg4990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 425 aa AA seqDB search
METGSEPFPPLPGTTTTTESATATRRRTRKASILGDDLKVGDTGSPSLATSIAHIQAAHS
NEPPSPPSTKRTSKRRKARTLLRRVKHTCVKHTWVLPLFLLSCFLLGYAINPTSSNPLSH
FLFLSYRLPLSETPGATHVQYGKGLWDIAFVTFYTVVLSFTREFIMQEVLRPLSRWVGLK
SRGKQARYMEQMYTALYFGIMGPCGMWVMSRTPIWYFDVVGMYEGYPHKTHDGAFKFYYL
FQAAYWAQQAIVLLLGMEKPRKDFKELVGHHIVSLALIGLSYRFHFTYMGLAVYITHDIS
DFFLATSKSLNYVDHPITGPYYFLFMCSWIYLRHFLNLKILVSLFNEFKTVGPYVMDWEG
GSYKCDLAFWITGGLLGSLQALNLFWLFFIVRIAYRFVRDREASDDRSEDEGSGDEGEQQ
NGKKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggagacgggatcagagcccttcccgcctctgcccggcaccaccaccaccaccgagagc
gcgacggcgacgcgaaggaggacgagaaaggcgagcatcttgggagatgacttgaaagtg
ggcgacaccggctcgccgtcgcttgctacgagcattgcgcacatccaggcagcccactcc
aatgaacccccctcccccccatcaacaaaacgcacctccaaacgccgcaaagcccgcacc
ctcctccgccgagtcaagcacacgtgcgtaaaacacacttgggtcctccccttgttcctg
ttgtcttgcttcctcctcggctacgcaatcaaccctacctcctccaaccccctctcccac
tttttgttcctgtcgtacagactccccctgtcggaaaccccgggggcgacccacgtccag
tacggcaaggggctctgggacatcgcctttgtgaccttttacaccgtcgtcctctccttc
acgcgcgagttcatcatgcaggaggtcctccgcccgctctcccgctgggtcgggctcaag
tcgagggggaagcaggcgagatacatggagcagatgtacacggcgctctactttggcatc
atgggcccgtgtggcatgtgggtcatgtcgaggacgccaatctggtactttgatgtcgtg
gggatgtacgaaggttacccgcacaagacgcacgacggggcgtttaaattttattatctc
ttccaggcggcgtactgggcccagcaggcgattgtgttgttgcttgggatggagaagcca
cgaaaggactttaaggagctagtcggccaccatatcgtctcgcttgcgctcatcggtctg
agctacaggtttcactttacgtatatggggcttgcggtgtacatcacgcacgacatttcg
gactttttcctcgccacttccaaatcgctgaattatgtcgaccatccgatcacgggaccg
tactatttcttgtttatgtgctcttggatctacctgaggcattttttgaacttgaagatc
ttggttagcttgtttaatgagttcaagactgtcgggccgtatgtcatggactgggagggg
ggcagctacaagtgtgacttggcgttttggatcacggggggtttgctggggagcttgcag
gcgctgaatctgttttggttgtttttcattgtgaggattgcgtataggtttgtgagggat
cgggaggcgagtgatgataggagtgaggatgaggggagtggggatgagggggagcagcag
aacgggaagaagaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system