KEGG   Podospora anserina: PODANSg5054Help
Entry
PODANSg5054       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PODANSg5054
Peptidases [BR:pan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PODANSg5054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1516 aa AA seqDB search
MGGAPDLPQRSSSPLKRPASSMEPETDSTNLKEDVVMGTENESAAKAKEGKDEVMDGAPS
SPKQSTTESNGLPLRNDIPPLDQQIKTIETLVKAFAETPIQEGDEAYLVSRKWLQRAQAF
GLDSKHVSKEVPEGSLGPVDNSDIIETKFTDSNGVECVKLKPGLGTESFELFPKDAWDLL
LFWYGLATGQAPIIRLAHNTAPDAVSDPVIQFEFHPPVFTIHRLWSATSPIPIEQEIKLK
KPPPPIVVQSTSFSYHKFLRRVKELASVAPDRKVRVWRVLQTIPATETPASEPSESSGMM
KTPPDSPVQEVGVPDGFPAVPGAWPEMLVDVVTFGQLEKGVQRALVEAQDTTVHANYNGK
RSLSLVGLNVDQTLVLDEEVERQDWVSTYSGSNGKNLTTRNSSTAVVQARANVSGRSSPA
LSAPLTRGRAQQKSGRTHGCVGLQNLGNTCYMNSALQCLRAVEELTKYFLTHEAKKEINT
DNPLAHGGDVALSYGRLLEEIYKDPTPNSVAPRQFKSVIGRYAPAFSGYGQQDSQEFLGW
LLDGLQEDLNRILRKPYIEKPDSTDEMINNPAAIREMALQVWDITKRRDDSVISDLFTGL
YKSTLVCPECNKISITFDPFTNLTLPLPMANSWSREIRFYPLNDAPVNIVVDIDKNSSIK
GLKQFISQRVGVPVDRLMASEEFSGKFFKHYDDMATVSDDISSNDIVVVHELEAPPSNLA
LTKDPKKQKIKSLLADNDEEDLEDPMVQSMVVPVLHMCSQGKAKRKKSVLVPPHFIVLNP
EEACSEDIIRRKILEKVATFTTHPELAAVEETDAGDNIDPEMANVASDVDSSGDSKIVAK
SVEGEEDIVDVSMADANDAPKPAASSGVEQSSQALKAFKSQRPKWIDPEEFLAPQFQNLF
DLSFFPEGTMTIPTGWQSVTEGNAYPRLSTRQPKPIMSDVEMQSPGAWANSDASGSDEVN
EVTRMAEESSDDDSDFPHQVKSRAIEPPSHQVNARGGKKKMKARQQQMYGKKAKKRFEKQ
QKGRMQKQHASRRDTGPIEGPLVRLGEGIIVDWNEEAWEALFDGQPGESMRGCKTFENVD
TLVDPALEAKKKQRALRAKHGITLEDCLNEFEKEEILSEQDTWYCPRCKEHRRASKKFDL
WKTPDILVVHLKRFSSVGYRREKLDILVDFPVEGLDLTSRVIDKEDGKQEIYDLIAVDDH
WGGLGGGHYTAKAKNFNDGSWYEYNDTGVSKCSDPQKVVSAAAYLLFYRRRSETPLGGPK
FQEIFDKYDSQIASADQDMSDSGEGQRLGLSSSLRGSPSASTGAGLTLPRGKRGLVSDDS
DRAGQALVPADPELPSYQASVGNGDEDTEMGAALWDQSTLHNSIEGDEDEGIGLPDYDNG
GMAGMTSVIGSNWNFQNIKPGSVASDGDIASDIAQNDNSSNDDGFAAGDEMDEVFMSGPS
LEFIEHEPTFPEEEIPAPPAEAQNLFDQIAEDKWAQQQIHTVPADIADDHASDKVAEIRV
GDGGEDQQAQVQKPSA
NT seq 4551 nt NT seq  +upstreamnt  +downstreamnt
atggggggtgctcccgatcttccccagcggtcctcgtccccgctcaaacgacctgcctcc
agcatggagcccgaaacggacagtacaaacctgaaagaggatgtggttatgggaactgag
aatgaatctgctgcaaaggccaaagagggcaaggatgaagtgatggatggggctccatca
agcccaaagcagtccaccacagagtcaaatgggcttcctctacggaacgatattcctccg
ctcgatcagcaaatcaaaaccatcgagactctcgtcaaggcgtttgctgagactcccatc
caggagggtgacgaggcgtacctagtgtcaaggaaatggcttcaacgggcccaggccttt
gggctggatagcaaacatgtcagcaaagaggtgccagaagggtccctcggtccagtggac
aattcggacattattgagaccaagttcacagactccaatggagtagagtgtgtcaaactg
aagccaggcttgggaacggagagtttcgagctgttccccaaagatgcctgggatctcttg
ctcttctggtacgggctggctactggacaagctccgattatccggcttgcacacaacacg
gcccccgatgcggtttcggatcccgttattcagttcgagttccaccctcctgtgtttact
atacacagattgtggtcggccacgagcccgattcctatagagcaggaaatcaagctcaag
aagccaccccctcccattgtggttcagagtacgtccttcagctatcacaagttccttaga
cgagtcaaggagcttgccagtgtggcaccggaccgcaaggtgcgcgtatggcgagttctg
cagaccatccccgccacggaaaccccagcctcggagccctcagaatcctctgggatgatg
aagactcctccggactctccagttcaagaggttggcgttcccgatggatttcctgccgtc
cccggggcttggcctgagatgcttgttgatgtggtaacttttgggcagttggagaagggt
gtccaacgcgcccttgttgaggcacaggacacaactgtccatgccaactacaacggcaag
aggagcctgtcgctggtaggcctcaatgtcgatcaaacccttgttctggacgaagaagtg
gagcgtcaggactgggtgtctacatatagcggttccaacggcaagaatttgacaactagg
aatagctcaaccgctgtcgttcaggcccgggccaatgtcagcggacgtagcagccccgcg
ctttcggcacctctcaccagaggccgcgcccagcaaaagtcggggcggacccacggctgt
gtaggactccagaacttgggcaacacgtgctacatgaactctgctcttcagtgtctgcgt
gccgtcgaggaactcacaaagtatttcctcactcatgaagcgaaaaaggagatcaacacc
gacaatcctctcgcccatggtggagatgttgccctctcctacggacggctgcttgaagaa
atctacaaggatcccacaccaaactcggttgcaccacgccaattcaagagcgttatcggt
cggtatgctcctgccttctcgggatatggccagcaggattcgcaagagttccttggctgg
cttctcgacggtctccaagaggatctcaatcgcatcctcaggaagccgtacattgagaag
cccgactctaccgacgagatgatcaacaaccctgcagcgattcgggagatggccctccag
gtttgggacattacgaagcggagagatgactcggtcatctctgatctgttcaccggcttg
tacaagtctactcttgtgtgccccgaatgcaacaagatcagcatcacgttcgaccctttc
accaacctgacccttcccctccccatggcaaactcgtggtccagagagattaggttctat
ccgctgaatgatgcacccgtcaacattgtcgttgatatcgacaagaacagcagcatcaag
ggattgaagcagttcatttcgcagcgtgtcggggtacctgtcgaccgtctcatggcttcc
gaggaattctcgggcaaatttttcaagcactatgatgacatggcgactgtctctgacgac
atctctagcaacgatatcgtcgttgttcatgagctcgaggctcccccctcaaacctggcc
ttgaccaaagacccaaagaagcaaaagatcaagtctcttttggctgacaatgatgaggaa
gacttggaggatcctatggtacaaagcatggttgttcctgtcttgcacatgtgttcacag
ggcaaagccaagcgcaagaagagcgttctggtgccgccgcactttatcgtgctgaaccca
gaggaggcatgcagcgaagacatcatccggcggaaaatcttggagaaggtggcgacgttt
accacacatcctgaacttgctgcggtggaggaaaccgacgcaggcgataatattgatccg
gagatggccaatgtggcctcggatgttgattcttcaggcgactccaagatagtagcgaag
tcggttgagggtgaagaagacattgtcgacgtcagcatggctgatgcaaacgatgcgccc
aagccagcagcgtccagcggggttgaacaatcctcacaggcgctgaaggcattcaagtca
cagcggcccaagtggatagaccccgaagagttcctcgcgccacagttccagaacctgttt
gatctcagcttcttcccggaaggcactatgaccatacctactgggtggcagtctgtgacc
gaggggaatgcgtacccgagactcagcaccaggcagccaaagccgataatgtcggatgtc
gagatgcagagccccggagcttgggccaactctgatgctagcggcagcgacgaagtgaac
gaggtcactcgcatggcagaggaatccagcgatgatgactcggatttccctcatcaagtc
aagtcacgagcgattgaaccgccatcccaccaagtgaacgcgcgcggtggtaagaagaag
atgaaggctcgccaacagcagatgtatggcaagaaggccaagaagcggttcgaaaagcaa
cagaagggccgcatgcagaagcaacacgcaagccggcgtgataccggtcccattgaaggt
cccctggtccgtctaggtgaaggtatcatcgtggactggaacgaggaggcctgggaggct
ctctttgacggccagccaggagagtcaatgcgcggctgcaagacctttgagaatgtagac
actctggtggaccctgcccttgaagccaagaagaagcaaagagctctgcgtgcgaagcat
ggcattacacttgaggattgcctgaacgagtttgagaaggaggaaatcctgtcagagcag
gatacgtggtactgcccacgctgcaaagagcatcgacgggctagcaagaagttcgatctc
tggaagacaccagacattctagtcgtccacctcaagcggttcagttctgttggataccgc
agggaaaagctcgacattctggttgactttccagtggaaggactcgatctgacttctcgg
gtcatcgacaaggaagacgggaaacaagagatttacgacctcattgccgttgatgaccac
tggggtggtttgggtggtggtcattatactgccaaagccaagaacttcaatgatggctcc
tggtatgagtataacgacacgggtgtgagtaagtgcagcgatcctcaaaaggttgtcagt
gctgctgcgtaccttctcttctacagaagacgctctgaaacaccgctgggcggacccaag
tttcaggagatcttcgacaaatatgacagccagattgcctccgccgatcaagacatgtcc
gactcgggggaagggcagcgtctcggcctaagctcctcccttcgtggatcgccgagcgct
tcgaccggagcaggtctaactctccctcgaggaaaacgtggtttggttagcgacgactct
gaccgcgcgggacaggcccttgtccctgctgaccctgaactgccatcctatcaggcaagc
gtggggaatggtgacgaggataccgagatgggcgctgcgctgtgggatcaatccacgttg
cacaacagcattgagggtgatgaggatgagggcatcggccttcccgactacgacaatggc
ggtatggccggcatgacttcggttattggctcgaactggaatttccagaacatcaagcct
ggctcggtggcgtctgacggggacattgctagcgatattgcgcagaacgacaactcgtcc
aacgacgacggctttgcggccggggacgagatggatgaagtcttcatgagtggtccatca
ctggaatttattgagcatgagccgacattccccgaagaagagatcccagcgcctcccgcc
gaagcacagaacctgtttgatcagatagccgaggacaaatgggcacagcagcagattcac
accgtacctgccgatattgccgatgatcatgccagcgacaaggttgctgagatacgggtt
ggtgacggaggcgaggaccaacaggctcaggtgcaaaaaccgagtgcttag

DBGET integrated database retrieval system