KEGG   Podospora anserina: PODANSg509Help
Entry
PODANSg509        CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pan  Podospora anserina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PODANSg509
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PODANSg509
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PODANSg509
Enzymes [BR:pan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PODANSg509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 711 aa AA seqDB search
MEGLKQTFARCKAQNRSALVTYVTAGFPNPAATPDVLLAMEKGGADVIELGVPFSDPIAD
GPTIQTANTIALQHGVTTEGVLDMVRVARKRGLKAPILLMGYYNPLLSYGEERLLKDCKE
AGVNGFIIVDLPPEEAVSFRRLCTRGGLSYVPLIAPATSDARMRILCQLADSFIYVVSRQ
GVTGASGTLNAHLPELLARVKKYSGDKPAAVGFGVSTRDHFQSVSQLADGVVVGSQIVTT
IMNAAENEINKAVQEYCGYLCGRTTSPEEEATREVGILEAINGAQETGDVSVDAVIKETD
DLVAQLDMINSDLPKRFGEFGGQYVPESLMDCLSELEDGFNKIKDDPAFWEEYRSHYPWM
GRPGHLHLAERLTEHAGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKTKIIAETGA
GQHGVATATVCAKFGMECTVFMGAEDVRRQALNVFRMKLLGAKVVAVEAGSRTLRDAVNE
ALRSWVVNLEDTHYIIGSAIGPHPFPTIVRTFQSVIGRETKQQMLEKRGKLPDAVVACVG
GGSNAVGMFYPFAEDRSVKMLGVEAGGDGVDTLRHSATLTAGSKGVLHGVRTYILQNEHG
QIDETHSVSAGLDYPGVGPELSNWKDTDRAKFIACTDAQAFIGFRLMSQLEGIIPALESS
HGIWGAIELAKTMKKGEDVVICLSGRGDKDVQSVADELPKIGPVIGWDLRF
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcctcaagcagacgtttgctcgctgcaaggcgcagaacaggtctgcccttgtc
acctatgtcacggccggtttccccaaccccgcagccactcccgatgtccttctggctatg
gagaagggcggcgccgatgttattgagctcggcgttccgttctctgacccaattgccgat
ggccctaccatccagactgccaacaccatcgctctccagcatggcgtgaccaccgagggc
gtcctcgacatggtccgcgtggcccgcaagcgtggcctcaaggctcccattctcctcatg
ggctactacaaccccctcctcagctacggcgaggagcgtctcctcaaggactgcaaggaa
gccggtgtcaatggcttcatcattgtcgatctgccccccgaggaggccgtctccttccgc
agactctgcacccgcggcggtctctcctacgtccccctcattgctcccgccacctcggat
gcccgcatgcgtatcctctgccagctcgccgactccttcatctacgtcgtctctcgccag
ggcgtcaccggtgctagtggcaccctgaacgctcacttgccggagctcctcgcccgtgtg
aagaagtacagtggcgacaagcccgcggccgtcggtttcggtgtcagcactcgcgatcac
ttccagtccgtgtctcagcttgcagatggtgttgtcgtcggcagtcagattgttactacc
attatgaacgccgccgagaacgagatcaacaaggctgtccaggagtactgcggttacctt
tgcggtcgcaccacctcccccgaggaggaggccacccgcgaggttggcattctcgaggcc
atcaacggtgctcaggagactggagatgtgtccgtggatgctgtcatcaaggagacggat
gaccttgttgcccagctcgacatgatcaactctgatctccccaagcgtttcggcgagttt
ggtggccagtacgtcccggagtccctgatggactgcctttccgagcttgaggacggcttc
aacaagatcaaagatgacccggctttctgggaggagtaccgctctcactacccctggatg
ggccgccccggtcacctccatctggctgagcgcctgacggaacacgctggtggtgcgaac
atctggcttaagagagaggatctcaaccacaccggttcccacaagatcaacaatgccctc
ggtcagctccttctcgccaggagattgggcaagaccaagattattgccgagaccggtgcc
ggccagcacggtgtagccacagctaccgtctgtgctaagttcggcatggagtgcaccgtt
ttcatgggcgctgaggatgttcgccgccaggctcttaatgtgttccgcatgaagcttctc
ggcgccaaggtcgttgccgtcgaggctggcagtcgcaccctccgcgacgccgtcaacgag
gctctccgctcttgggtcgtcaacctcgaggacacccattacatcattggatctgccatc
ggtccccaccccttccccaccattgtccgcaccttccagtccgtcattggcagagagacc
aagcagcagatgctcgagaagcgtggcaagctccccgatgccgtcgttgcttgcgtcggt
ggcggctccaatgccgtcggcatgttctaccccttcgccgaggacaggagcgtcaagatg
ttgggcgtggaggctggtggtgacggtgtcgatacccttcgccacagtgctactctcact
gctggctccaagggtgttctccacggcgtccggacctacatcctccagaacgagcacggc
cagatcgacgagacccactccgtctccgccggtctcgactaccccggcgtcggccccgag
ttgtccaactggaaggataccgaccgtgccaagttcattgcttgcactgatgcccaggcc
tttattggtttccgtctgatgagtcagctggagggtatcattcccgcccttgagtcttcc
cacggtatctggggcgccattgagctcgccaagaccatgaagaagggcgaggacgttgtc
atttgcctgagcggtcgtggcgacaaggacgtgcagagcgttgctgatgagctgcccaag
attggacctgtcattggctgggacttgcgcttctaa

DBGET integrated database retrieval system