KEGG   Podospora anserina: PODANSg509Help
Entry
PODANSg509        CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pan  Podospora anserina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PODANSg509
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PODANSg509
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PODANSg509
Enzymes [BR:pan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PODANSg509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 711 aa AA seqDB search
MEGLKQTFARCKAQNRSALVTYVTAGFPNPAATPDVLLAMEKGGADVIELGVPFSDPIAD
GPTIQTANTIALQHGVTTEGVLDMVRVARKRGLKAPILLMGYYNPLLSYGEERLLKDCKE
AGVNGFIIVDLPPEEAVSFRRLCTRGGLSYVPLIAPATSDARMRILCQLADSFIYVVSRQ
GVTGASGTLNAHLPELLARVKKYSGDKPAAVGFGVSTRDHFQSVSQLADGVVVGSQIVTT
IMNAAENEINKAVQEYCGYLCGRTTSPEEEATREVGILEAINGAQETGDVSVDAVIKETD
DLVAQLDMINSDLPKRFGEFGGQYVPESLMDCLSELEDGFNKIKDDPAFWEEYRSHYPWM
GRPGHLHLAERLTEHAGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKTKIIAETGA
GQHGVATATVCAKFGMECTVFMGAEDVRRQALNVFRMKLLGAKVVAVEAGSRTLRDAVNE
ALRSWVVNLEDTHYIIGSAIGPHPFPTIVRTFQSVIGRETKQQMLEKRGKLPDAVVACVG
GGSNAVGMFYPFAEDRSVKMLGVEAGGDGVDTLRHSATLTAGSKGVLHGVRTYILQNEHG
QIDETHSVSAGLDYPGVGPELSNWKDTDRAKFIACTDAQAFIGFRLMSQLEGIIPALESS
HGIWGAIELAKTMKKGEDVVICLSGRGDKDVQSVADELPKIGPVIGWDLRF
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcctcaagcagacgtttgctcgctgcaaggcgcagaacaggtctgcccttgtc
acctatgtcacggccggtttccccaaccccgcagccactcccgatgtccttctggctatg
gagaagggcggcgccgatgttattgagctcggcgttccgttctctgacccaattgccgat
ggccctaccatccagactgccaacaccatcgctctccagcatggcgtgaccaccgagggc
gtcctcgacatggtccgcgtggcccgcaagcgtggcctcaaggctcccattctcctcatg
ggctactacaaccccctcctcagctacggcgaggagcgtctcctcaaggactgcaaggaa
gccggtgtcaatggcttcatcattgtcgatctgccccccgaggaggccgtctccttccgc
agactctgcacccgcggcggtctctcctacgtccccctcattgctcccgccacctcggat
gcccgcatgcgtatcctctgccagctcgccgactccttcatctacgtcgtctctcgccag
ggcgtcaccggtgctagtggcaccctgaacgctcacttgccggagctcctcgcccgtgtg
aagaagtacagtggcgacaagcccgcggccgtcggtttcggtgtcagcactcgcgatcac
ttccagtccgtgtctcagcttgcagatggtgttgtcgtcggcagtcagattgttactacc
attatgaacgccgccgagaacgagatcaacaaggctgtccaggagtactgcggttacctt
tgcggtcgcaccacctcccccgaggaggaggccacccgcgaggttggcattctcgaggcc
atcaacggtgctcaggagactggagatgtgtccgtggatgctgtcatcaaggagacggat
gaccttgttgcccagctcgacatgatcaactctgatctccccaagcgtttcggcgagttt
ggtggccagtacgtcccggagtccctgatggactgcctttccgagcttgaggacggcttc
aacaagatcaaagatgacccggctttctgggaggagtaccgctctcactacccctggatg
ggccgccccggtcacctccatctggctgagcgcctgacggaacacgctggtggtgcgaac
atctggcttaagagagaggatctcaaccacaccggttcccacaagatcaacaatgccctc
ggtcagctccttctcgccaggagattgggcaagaccaagattattgccgagaccggtgcc
ggccagcacggtgtagccacagctaccgtctgtgctaagttcggcatggagtgcaccgtt
ttcatgggcgctgaggatgttcgccgccaggctcttaatgtgttccgcatgaagcttctc
ggcgccaaggtcgttgccgtcgaggctggcagtcgcaccctccgcgacgccgtcaacgag
gctctccgctcttgggtcgtcaacctcgaggacacccattacatcattggatctgccatc
ggtccccaccccttccccaccattgtccgcaccttccagtccgtcattggcagagagacc
aagcagcagatgctcgagaagcgtggcaagctccccgatgccgtcgttgcttgcgtcggt
ggcggctccaatgccgtcggcatgttctaccccttcgccgaggacaggagcgtcaagatg
ttgggcgtggaggctggtggtgacggtgtcgatacccttcgccacagtgctactctcact
gctggctccaagggtgttctccacggcgtccggacctacatcctccagaacgagcacggc
cagatcgacgagacccactccgtctccgccggtctcgactaccccggcgtcggccccgag
ttgtccaactggaaggataccgaccgtgccaagttcattgcttgcactgatgcccaggcc
tttattggtttccgtctgatgagtcagctggagggtatcattcccgcccttgagtcttcc
cacggtatctggggcgccattgagctcgccaagaccatgaagaagggcgaggacgttgtc
atttgcctgagcggtcgtggcgacaaggacgtgcagagcgttgctgatgagctgcccaag
attggacctgtcattggctgggacttgcgcttctaa

DBGET integrated database retrieval system