KEGG   Podospora anserina: PODANSg5153Help
Entry
PODANSg5153       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pan  Podospora anserina
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PODANSg5153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1727 aa AA seqDB search
MAEFRVLEGLQALHSELVAVRQHRFDNISVLENLIELHSDNLKALVDKTPRNSTHRNDIT
NKKVIKTKDGEFKVNDDFIFETLKVADELDLDEYEAGRIILDCQDEDDSEIQSRPLWECG
LIRFHQERKYLLDCMRLCIELANDEEMDDNLKDAFGKILEEKIFVKGSSKKIVARCMEAM
QTIKAMLQSINERVASRYMLEQASLARPPEAADTIEFSRMSLVEQHECLAMILHAAVEKQ
YADINDFKQFLGTLKKIDKYDQFLVHLFPVLAAYINVFGSPDGMCDFQQSRQLDQEILKT
GDGDSWAISYLGAATRVWWIAEYTGYFQVDNEFDLGGLDLDVEFDKRTKAFTEALKEGAF
DFILSVAADCKTEEWQDPSRMGMRQWLQRKSPPLQGDFYYFSHFLQLSLMAHLEVFIDSV
ITNLPELVRTLKTEEDEQRQLSQTHEQDLDLERFVVIISYAYEDRPDAAMTFFEDPDSAL
YGFLQWASTKASTPLVSAFCEMLQALACNEETATAAHTFLLDEGHQSSGKMRRSQSLTWN
QIFRELEFFAKKLSERPNPAQMQIQRPGKPGTDQGEAEPESAMMLECYVRLIGKLTAESS
TCRTRLATTQELTFPEILFRLANANVTPRLRAAVFYSLRSLLVMKSVSESNIIWTLVDNF
TMGALDPNNPATAQQQRSPTYQSTYEELQERAFNDLSTGFEEPNAFIQLLTSLVTPYTVS
DGLNDTLPFPEFLGVNKRRPGIEIYVDFVFLMFTMKPREIVDQGQLRMLRLSCLEFILAC
LQTFNEDLIVLGNETNIEIDKAVKTTSLAVYVRLHPFARVMEWMYSEKAITALMDTIHQD
QYALSRASPHSPLIQSILRGIQVLIKVLDLQATFIHLVRPVIQSEAGKRRPLTLAKSTYT
SIEDGILNHLTLLVDLGKYCNLGVSELTLSCLKLLEKVSTSSKLISAWNPDTHRPGHRNK
AIVQLEKDGEGEVIGTSLAASINAVIDPALETESEEYLIKLFILDFLYETLRASPDQPTI
AHLLLGFNCELRGLSVAPNGVFDNQRSLFHSLLGVVIELVVNEGDRGMRGYLITLKYKIL
RIFQLLWKSPLSSTLVMEELRSTNFLFHMLLRESQIVPGLPWNDMTLDDNSFLLSTASVA
YIDYLGSRAIVFEYIAKELCSVSQNRIPSIKRQIFDALNGQITLENQETLAAHNIFDFFD
FMNVDISWEVAPPQFHFYHELDLSPCVIDAGGAGIQYNLSRVKECIQLKPEEQVLLEYLL
FNNRRVLVRAVRLELLKKWSDLLLVMFEANEFRGTVKTTFLLQALQAILPTLESLNTDNP
PEAFELAKVAKILLYKLDFSDNTGGAPGLETDKIAMGNLVSEKLFQLFQVCLASIVKWNQ
FAELRGLYYSICYRYLTGVVDNDGGDTRSSSLLTARIRTHKAIQNHGEKLLHVICDDAYG
SDTLCQTAAMVLLSALVHISRSSPHTNPTSISVIESLNRLNFIGVLVDSLKTILREWLAI
INPPSPLPASTAEATEQYLTAKLCFLLQLAQTKTGAMYILQANLFRALEISGVFAADPEL
EINPSNTVALEKHYFLLVSLARIITASVLSRGQGNIVQARGFLQRHRMLVVHTLKRAAGI
GIVGNGMWGGGEEQQQERSISDGFSFGPTVSPVDSILGGGKKGPLNNNNNNNNNNNNNKE
AQRRLEERIGELGESLMVLIGGVGVLEYELDQLPAERASVVNTTLFH
NT seq 5184 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtttcgcgttctcgaggggctacaggccctccactcggagctggttgctgtt
cgccaacaccgttttgacaacatctcagtcctagagaacctgatcgagctgcattccgac
aatttgaaggcgctggttgacaagacaccacgaaactctacccatagaaacgacatcacc
aacaaaaaggtaatcaagaccaaggacggcgaattcaaggtcaacgatgacttcatcttc
gagactctcaaggtcgccgacgagttggatctggatgagtacgaggctggaaggattatt
ctggattgccaggacgaggacgactcggaaatacagtcacgcccgctatgggaatgcggt
ctcatccgcttccaccaagagcgaaaatacctactcgactgcatgcggctctgcatcgaa
ttagcaaacgacgaggaaatggacgacaatttgaaggatgcctttgggaaaattctggag
gaaaagatcttcgtcaagggctcaagcaaaaagattgtcgcgagatgtatggaggctatg
caaaccatcaaggctatgttgcagagcatcaacgagagggtggcgtcccggtacatgcta
gaacaagccagtctcgcccggcccccagaggctgccgacacgattgagttctcccgcatg
agcctcgtggagcagcatgagtgtcttgccatgatactgcacgctgccgtggaaaagcag
tacgccgatatcaacgacttcaagcagtttttggggacgctaaagaagatcgataagtac
gatcaatttctcgttcatctattccctgttttggccgcctacatcaacgtgtttggctca
ccagatggcatgtgtgacttccagcagtctcgccagttggaccaagagatcttgaaaact
ggagatggtgacagctgggctatttcgtatctgggagcggccacgcgggtctggtggatt
gccgagtacactggatacttccaagtcgataacgaattcgatcttggtgggttggatctg
gacgtcgagtttgacaagagaacaaaggcatttacagaggccctcaaggagggggcattc
gactttatcctttctgtggcggccgattgcaagacggaggagtggcaagatccatcacgc
atgggaatgcggcagtggttgcaacggaagtcacctcctctccaaggtgatttctactac
ttcagccatttcctccagctcagcctgatggcccacctggaggtgtttatcgactctgtc
atcacaaacctacccgagctcgtcaggacattaaaaacagaggaggatgagcagcgccag
ctgagccaaacccacgagcaagacctcgacctcgagcggttcgtggtcatcatctcgtat
gcgtacgaggacaggccagatgccgccatgaccttcttcgaggacccagatagtgctctg
tatggtttcctacaatgggcgtccacaaaagcatcaacgcccctggttagtgcgttttgc
gagatgctacaggctctggcctgcaacgaggagactgcaacggctgctcatacatttttg
ctcgacgaggggcaccagtcttctggcaaaatgaggcgatcccaatcgctgacctggaac
caaatctttagggaattagagttctttgccaagaaactgagcgagaggcccaacccagcg
caaatgcagatccagcgtccaggcaaaccgggcaccgatcagggagaggccgagcctgaa
tcggccatgatgctggagtgctatgttcggttgattggcaagctcacagcggagagcagc
acctgcagaaccaggttggcaacgacacaggaactcacgtttcccgagattctgttcagg
ttggcaaatgcgaacgtcactccccggcttcgcgccgctgtcttttacagcttaagatca
ctgttggtgatgaagtcggtttccgaaagtaacataatatggactcttgtggacaacttc
actatgggagctctggaccccaacaacccggcgactgctcaacaacagcgaagtcctaca
tatcagtcgacgtacgaagaactgcaggaacgcgctttcaacgatttatccactggcttt
gaagagccaaacgcattcatccagcttcttacgtcgttggtcacgccctacacagtctcc
gatgggctcaacgacaccttgccgttccccgagtttctcggtgtgaacaagcgaagaccc
gggatagagatctatgttgactttgtgttcttgatgttcaccatgaagccgagggaaata
gtagaccaaggccaactgagaatgctgcgtctctcctgcctagaattcattctggcatgc
ttgcaaaccttcaacgaagacctgatcgtcctgggcaacgagacaaacatcgagattgac
aaggctgtgaaaacgaccagtctcgcggtttatgttcgccttcatccttttgctcgcgtt
atggaatggatgtatagcgaaaaggccatcactgccctgatggataccattcatcaggac
cagtatgccctcagccgggcttcacctcactcgcccttgatccagagtatcttacgtggg
atccaggtgctgatcaaggttctcgaccttcaggcgacctttattcacttggtgcggcct
gtgattcaatccgaggccgggaagcggaggccgcttactctggccaagagcacgtatacg
tccattgaggatggaattctcaaccatctgacactgctggttgatctgggcaagtattgc
aacctcggggtcagcgaactcactctttcctgtctcaagctgctagagaaggtttcaact
tccagcaagcttatttcggcatggaatcccgacacccatcgcccaggacaccggaacaag
gccattgtccagcttgagaaggatggcgagggcgaggtcatcggaacatcacttgctgct
agcatcaacgcggtgatcgatccggcgctcgagacagagtcggaagaatacctgatcaaa
ctcttcattctcgactttttatacgagaccctcagggcatcacccgaccagcccacgatt
gcgcatttgcttctcggtttcaactgcgagctgcgggggttgagcgttgcgcccaacggg
gtgtttgacaaccagagatccctcttccacagcctgttgggtgtggtcatcgaactggtg
gtgaatgagggtgatcgaggaatgcgcggatacttgattacgctcaagtacaagattctc
cgcatcttccagctgctgtggaagtcgccgctttcgtcgactttggtgatggaagagttg
aggtcaaccaactttctgttccacatgcttctgagagagtcacaaatcgtgccggggctg
ccgtggaacgatatgacgctggatgacaattcgttcctcctgtcgacggcgtcggttgcg
tatatcgactacctcggttcgagggccattgtctttgagtatattgccaaggagctgtgc
agcgtttcgcagaacaggataccgtcgatcaagcgtcagatttttgatgctctcaatggg
cagatcacgctggagaaccaggagacgttggcggcgcacaatatttttgacttttttgat
ttcatgaatgttgatatctcgtgggaggttgcgccgccgcagtttcatttctaccatgag
ctcgacctgagcccgtgtgtgatcgacgctgggggggcggggatacagtacaatctctcc
agagtgaaggagtgcattcagctcaagccggaggagcaggtgctgctggagtatctcctg
ttcaacaaccgccgggttttggttcgggctgtcaggcttgagctgctgaagaagtggtcg
gatctgttgctggtcatgttcgaggccaatgagttcaggggcacggtcaagacgacgttc
ttgctgcaggcgctgcaggctattctgccgacgttggagtcgttgaacacggacaatcct
cccgaggcgtttgagctggcaaaggtggccaagatccttctttacaagcttgacttttcg
gataataccggcggtgcgcctgggttggagacggataagattgccatggggaatctggtc
agcgagaagctgtttcagcttttccaggtatgtctggcgtctattgtcaaatggaaccag
tttgccgagctgcgcgggttatactacagtatctgttaccgctaccttactggggtggtg
gacaacgacggcggcgacacgcgcagctcgagcctcctcacggcgaggatcagaacccac
aaggccatccagaaccacggggagaagctccttcacgtcatctgcgatgatgcttatggg
tctgacacgctctgccagaccgctgccatggtccttttatcagctctagtccacatatcc
cgctcctcgccgcacaccaacccaacatccatttccgtcattgagtccctcaacaggctc
aacttcatcggcgtcttggtcgactcgctgaaaacaatcctgcgagaatggctcgcgatt
atcaaccccccttctcctctccccgcctcaacagcagaagcgacggagcagtacctcacc
gccaaactctgcttcctcctccagctcgcccagacaaaaacaggggcgatgtacatcctc
caagccaacctcttccgcgcgttggaaatctcgggggtgtttgccgccgacccagagctg
gagatcaacccgtccaacactgtcgcgttggaaaaacactactttttgcttgtgtcgctg
gctaggattattactgctagtgtgctgtcgagggggcaggggaatattgtccaggcgagg
gggtttttgcagaggcacaggatgttggttgtgcacacgctcaagagggcggcggggatt
gggattgtggggaatgggatgtggggaggaggggaggaacaacagcaggagaggtcaatt
agtgatgggttctcttttgggccgaccgtgagccccgttgattccatactgggcggtggg
aagaaggggccccttaataacaacaacaacaacaacaacaacaacaataacaacaaggag
gcgcagaggaggttggaggagaggattggggagttgggggagagcttgatggttttgatt
gggggggtgggggttttggagtacgagctggatcagctgccggctgagagggctagtgtt
gtgaatacgacactgttccattga

DBGET integrated database retrieval system