KEGG   Podospora anserina: PODANSg5165Help
Entry
PODANSg5165       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pan  Podospora anserina
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pan00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 919 aa AA seqDB search
MGEDARASGPVLEGRIEERPRVNGVRLRKEDSTDSASPNNSKMDSRGTSMSPDDTKSAGE
TAATPDHASAPKLSRKSSQKPVRSPPTLFDHLPDVTAQACSTFQVINDCLYGSRNMGSSD
HDALDCDCTEEWRNDENHACGEDSDCINRATKIECVDGDCNCGPGCQNQRFQRKQYADVS
VIKTDKKGFGLRANRNLQPNDFIFEYIGEVINEPTFRNRMIKYDREGIKHFYFMSLTKSE
FVDATKKGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAGRPIRAGEELVFNYNVDRYGA
DPQPCYCGEQNCVGFIGGKTQTERATKLSLATIEALGIEDSGDSWDTTVAKKPRRKKVTE
DDEDYVNSFQPKSLDEDGVNKVMATLMQCKEKWIAVKLLTRLQATEDEQLRHRVVRMHGY
QILKTTLNSYKDDTNVVLQVLDILYDLPRITKNKIADSNIEAAIQPLTTSTHEEVAFQAN
RLLEEWSKLSTAYRIPRKEKDAAAHATSNPFEERRNMDRDEPHKHANNSLANLNIPTGPR
NKVPQRNVGFFNGQRPPRKLPSNLPEGWHVTTDNTGRYYFYDVNGKVQWQRPTAPAVSTP
KTSTKAQQGQKAVQDIIDSLTKEITPRHSATHTPQRSSTPTTEPKKEKWRSLPIEKQMKI
YENTLFPHVKYVVEKFHGKLPKEDLKKFAREVNKKLVSSDYKNNRVEDPTHISSKQEKKV
KKYVRDFFDRAVVKYKEQQKAKGNNKSTDSDKPSASLNDLGGSSAPTPVQDDITPLSQPS
SPSSPVGGRKRKRDDDDDDVVEGEETSQSPQDDNMSETPSVKRLKEEEDGDGDMIPSPPP
PPPPPVDTPLSEEQRAMREQEEELRRENEEAQRMEEENIQNNNHKNGQHMDVDMEEAGGD
DDKPLEHREQRGAQEVMSH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagacgctcgcgcttcaggaccggtgctggaaggcaggattgaggaaaggccg
agggtcaatggcgttaggttacgaaaggaggattcgaccgactcggcttccccgaacaac
tccaagatggattcgcgaggcaccagtatgtcgcccgacgacacaaagtctgcaggagag
actgcagcgactccagatcacgcctctgccccgaagctgtctcgcaagtcgtctcagaaa
cccgttcgaagtccccctaccttgttcgaccacctgccagatgtcacagcccaagcatgc
agcacgtttcaggtcatcaacgactgtctttatggctcgaggaatatgggctcgtcggat
cacgacgcgctggattgcgactgtaccgaagaatggcgaaatgatgaaaaccacgcttgt
ggcgaggattccgactgcatcaaccgcgcgaccaaaattgagtgcgtagatggagactgc
aactgcgggccgggttgtcaaaaccagcggtttcagcgcaagcagtatgccgatgtttcg
gtcatcaagaccgacaagaaggggttcggcctgcgggcgaaccggaacctgcagccaaac
gacttcattttcgagtacattggcgaggtcatcaatgagccgacgttccggaaccggatg
atcaagtacgaccgcgagggcatcaagcacttttacttcatgtcgctcaccaagagcgag
tttgtcgatgccactaagaagggcaacttgggccggttctgcaaccattcgtgcaatccc
aactgttatgtcgacaagtgggtggtgggcgagaagctgcgcatgggcatttttgccggc
cgccccatccgcgccggtgaggagctcgtgttcaactacaatgtcgaccgctacggcgcc
gacccccagccatgttactgcggtgagcaaaactgcgtcggcttcatcggcggcaagacg
cagacagagcgtgcgaccaaactgtctcttgccacgattgaggccctcggtatcgaggac
agtggcgacagctgggacaccaccgttgccaagaagcctcgcaggaagaaggtcaccgaa
gacgacgaagactatgtcaacagcttccagccgaaatcccttgatgaagatggcgtcaac
aaggtcatggccactctgatgcagtgcaaggagaagtggattgctgtcaagctgcttacc
cgccttcaggccacagaagacgagcagcttcgccatagagtggtgaggatgcacggctac
cagattctcaaaacgacactcaactcgtacaaagacgacaccaatgtcgtcctgcaggtt
ctcgatatcctctacgacctgccgcgcatcaccaagaacaagatcgccgactccaacatc
gaggcagccatccagcccctgaccacttcgactcatgaagaggtcgccttccaggccaac
agactgctcgaggaatggagtaagctctcgacagcgtaccgtattcctcgcaaggaaaag
gatgccgcagctcatgcgacttctaacccatttgaggagcgtcgcaacatggatcgcgac
gagcctcacaagcacgccaacaactccctggccaacctaaacattccgacgggcccgcgc
aataaggtaccgcaaaggaacgtcggtttcttcaatggccaacgtccaccacggaagctg
cccagcaatctgcccgagggctggcacgtcaccacggacaatacaggccggtattacttt
tacgatgtcaatggcaaagtccagtggcagcggcccaccgcgccggcggtttccactccc
aaaacttcgaccaaagcccagcagggccagaaggcggtgcaggatatcattgacagcttg
actaaggagatcacgccaagacattcggccacacataccccccagcggtctagcaccccg
accaccgaacccaagaaggagaagtggcgttctctcccaatcgagaaacagatgaagatc
tacgagaacacccttttccctcacgtcaagtacgtggtcgagaaattccacggcaagctc
cccaaggaggacctcaagaagtttgcccgcgaagtcaacaagaagctagtctcttccgat
tacaagaacaaccgcgttgaggaccccactcatatctcctccaaacaagagaaaaaggtc
aagaagtacgtccgtgacttttttgaccgcgccgttgtcaaatataaggaacagcaaaag
gccaagggcaacaacaaatctaccgactcggacaagccctcggcttcgttaaatgacctg
ggaggcagctctgccccgaccccggtccaagacgacattacacccctttctcaacctagc
tcccctagctcccccgttggtggtcgcaaaaggaagcgcgacgatgatgatgatgatgtt
gttgaaggcgaggagacttctcagtcaccgcaggatgataacatgtcggagacgccttcg
gtgaagcggctcaaggaggaggaggatggggatggggacatgatacctagtcctccgccg
ccgccgccgccgccggtggatacgccccttagtgaggagcagcgggccatgcgggagcag
gaggaggagctgaggagggagaacgaggaggcgcagaggatggaggaggagaatattcag
aataataaccacaagaacgggcagcatatggatgttgatatggaggaggctggtggtgat
gatgataagccgcttgagcatagggaacagaggggagcacaggaggtcatgagccactag

DBGET integrated database retrieval system