KEGG   Podospora anserina: PODANSg5177Help
Entry
PODANSg5177       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pan  Podospora anserina
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PODANSg5177
   01230 Biosynthesis of amino acids
    PODANSg5177
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODANSg5177
   00051 Fructose and mannose metabolism
    PODANSg5177
   00562 Inositol phosphate metabolism
    PODANSg5177
Enzymes [BR:pan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PODANSg5177
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PODANSg5177
  Exosomal proteins of bladder cancer cells
   PODANSg5177
  Exosomal proteins of melanoma cells
   PODANSg5177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 295 aa AA seqDB search
MARKFFVGGNFKMNGTKESIKAIIKNLNEAQLDPSVEVVIAPSHLYLPIAVDAVTASTVS
VSAQNVYAKPNGAHTGEVSVSQLKDLGLNWTITGHSERRAGGESDENVADKTKAAIDGGL
SVIWCCGESLEEREAGNTVAVVEKQLAALAAKLSGDDWKKIVIAYEPIWAIGTGKVATTE
QAQEVHAAIRKWLKAKVSDAVADETRILYGGSVTAKNSKDLAKQPDIDGFLVGGASLKPE
CKLLLLIAEKFCADNYQQSSTSSTPTSERAALSVLLGISVGLYGIFRTKKELARI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgtcggcggcaacttcaagatgaatggcaccaaggagtccatc
aaggccatcatcaagaacctcaacgaggctcaattggaccccagcgttgaggtcgtcatc
gccccatcccacctctacctccccatcgccgtcgatgccgtcaccgccagcaccgtctcc
gtctcggcccagaacgtctacgccaagcccaacggcgcccacaccggcgaggtctcggtc
tcccagcttaaggatctcggcctgaactggaccatcaccggccactcggagcgcagagcc
ggcggcgagtctgacgagaatgtcgccgacaagaccaaggctgccattgacggtggtctc
agcgtgatttggtgctgcggcgagtcccttgaggagcgcgaggctggcaacactgttgct
gttgtcgagaagcagcttgctgctcttgccgccaagctctctggggatgactggaagaag
attgtcattgcctatgagcccatctgggctattggtactggcaaggttgccaccactgag
caggcccaggaggtgcatgctgctatccgcaagtggctcaaggccaaggtttccgacgct
gttgctgacgagacccgtattttgtatggtggctcggtcactgctaagaacagcaaggac
ttggctaagcagccggatattgatggtttccttgttggcggtgccagcttgaagcccgag
tgtaagttactcctgctcatcgcggagaagttttgtgctgacaattatcaacagtcgtcg
acatcatcaactccaaccagtgagcgcgcggcactgtccgttttattgggaattagcgtg
ggcttatacgggatttttaggactaaaaaggagctagcgaggatatag

DBGET integrated database retrieval system