KEGG   Podospora anserina: PODANSg5248Help
Entry
PODANSg5248       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pan  Podospora anserina
Pathway
pan00330  Arginine and proline metabolism
pan00332  Carbapenem biosynthesis
pan01100  Metabolic pathways
pan01130  Biosynthesis of antibiotics
pan01230  Biosynthesis of amino acids
Module
pan_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PODANSg5248
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PODANSg5248
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PODANSg5248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 6192714
NCBI-ProteinID: XP_001908213
UniProt: B2AWW2
Position
7
AA seq 531 aa AA seqDB search
FIPTNLLPLSYKHPAMRGPRPLGVVIKLGECVRLSQLLDVNPLTNTKPSTPGTSSIVDEK
SHEPLLSILTLIVETAVKLRKDGHRVIIVSSGAIGVGLRRMDVEKRPKHLSKLQALAAIG
QCRLMSLWDSLFNHLRQPIAQILLTRNDIADRSRYLNAQRTINELLDMGVIPIVNENDTL
AVSEIKFGDNDTLSAVTAAMVHADLLFLMTDVDCLYDKNPRTNPDAQPIEVVEDISSLVA
DVSTAGSSLGTGGMSTKIVAARLATSAGVTTVITKSSNPGNIVNIVKYIQSSRSPGSPSK
SGSDSEEGDTPEIMSSSTSSLKKPAIPLHTRFLPSPHPVRDRYFWILHGLRPHGTLFIDT
GCYKALLNKAGLLPVGVVDVEGTFHQQEAVRICVVDKKHPGQQPQEVGRCLTNYSSAEVS
RIKGKHTSEIPGLLGYMDSEYVAQRESISFFSGFHGGGVSRPVTPVGSGVNLAGMVTPKR
RGAGTPAQEERRLEAEDKELEEEGLVMRGKKEEGQQVRFVEEVKIVGEEGK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttcatacccactaacttgttaccgttgtcttataaacatccagccatgaggggtcctcgt
ccacttggcgtcgtgatcaagctgggtgagtgtgtccgtctgagccaattattggatgtg
aatcctctgactaacaccaaaccctcaacaccaggaaccagctccatcgtcgacgagaag
agccatgaacccttgctctccatcttgacgttgatcgtcgagacagcagtcaaactcaga
aaagatggccacagagtcattattgtgtcttcaggagccatcggtgttggtctccggaga
atggacgtagaaaagagaccaaagcatctttccaaactacaggctctggcagccattggc
caatgcaggctcatgagcctgtgggacagcctgttcaaccacctcagacagcccatcgcc
cagattcttcttacaaggaatgatatcgctgatcgatcacgctacctcaacgcccaaaga
acaatcaacgagctcctcgacatgggcgtcatccccatcgtcaacgaaaacgacaccctc
gccgtctccgagatcaaattcggtgacaacgacaccctctctgccgtcacagccgccatg
gtccacgccgatttgttgttcctcatgacagacgtcgactgcctctacgacaagaacccc
cggacgaacccagacgcccaaccaatcgaagtagtagaggacatctcctccctcgtagca
gacgtctcaacggccggctcctccctcgggacggggggaatgtccaccaagatcgtcgct
gccagactggccacctcggcgggggtgacaacagtcattaccaaatcatccaacccgggg
aacattgtcaacattgtcaaatacatccagtcctcccggtcccccggctctccgtccaaa
tccggctccgactcggaggagggcgacactccagaaatcatgtcctcctccacctcctcc
ctcaagaaaccagccattcccctccacacccgcttccttccctcccctcacccagtcagg
gatcgctacttctggatcctgcacggtttacgcccccacggcacgttgttcatcgacacg
ggctgctacaaggcccttttgaacaaagccggtcttttacccgtcggagttgtcgacgtg
gaggggactttccaccagcaggaagcggtccggatctgtgtcgtggataagaaacaccct
gggcagcaaccgcaggaggtggggaggtgtctgacgaattattcgagcgcggaggtgagc
aggatcaaggggaagcacacgagtgagattccggggttgttggggtacatggacagcgag
tatgtcgcgcaaagggagagcatcagttttttcagcgggtttcacggcgggggggtgagc
aggccggttacgccggtggggagcggggttaacctggcggggatggtgacgcccaagagg
aggggggcggggacgccggcgcaggaagagaggaggttggaggcggaggataaggagttg
gaggaggaggggttggtcatgagggggaagaaggaggaggggcagcaggttaggtttgtg
gaggaggtcaagattgtgggggaggagggtaagtag

DBGET integrated database retrieval system