KEGG   Podospora anserina: PODANSg5248Help
Entry
PODANSg5248       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pan  Podospora anserina
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PODANSg5248
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PODANSg5248
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PODANSg5248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 531 aa AA seqDB search
FIPTNLLPLSYKHPAMRGPRPLGVVIKLGECVRLSQLLDVNPLTNTKPSTPGTSSIVDEK
SHEPLLSILTLIVETAVKLRKDGHRVIIVSSGAIGVGLRRMDVEKRPKHLSKLQALAAIG
QCRLMSLWDSLFNHLRQPIAQILLTRNDIADRSRYLNAQRTINELLDMGVIPIVNENDTL
AVSEIKFGDNDTLSAVTAAMVHADLLFLMTDVDCLYDKNPRTNPDAQPIEVVEDISSLVA
DVSTAGSSLGTGGMSTKIVAARLATSAGVTTVITKSSNPGNIVNIVKYIQSSRSPGSPSK
SGSDSEEGDTPEIMSSSTSSLKKPAIPLHTRFLPSPHPVRDRYFWILHGLRPHGTLFIDT
GCYKALLNKAGLLPVGVVDVEGTFHQQEAVRICVVDKKHPGQQPQEVGRCLTNYSSAEVS
RIKGKHTSEIPGLLGYMDSEYVAQRESISFFSGFHGGGVSRPVTPVGSGVNLAGMVTPKR
RGAGTPAQEERRLEAEDKELEEEGLVMRGKKEEGQQVRFVEEVKIVGEEGK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttcatacccactaacttgttaccgttgtcttataaacatccagccatgaggggtcctcgt
ccacttggcgtcgtgatcaagctgggtgagtgtgtccgtctgagccaattattggatgtg
aatcctctgactaacaccaaaccctcaacaccaggaaccagctccatcgtcgacgagaag
agccatgaacccttgctctccatcttgacgttgatcgtcgagacagcagtcaaactcaga
aaagatggccacagagtcattattgtgtcttcaggagccatcggtgttggtctccggaga
atggacgtagaaaagagaccaaagcatctttccaaactacaggctctggcagccattggc
caatgcaggctcatgagcctgtgggacagcctgttcaaccacctcagacagcccatcgcc
cagattcttcttacaaggaatgatatcgctgatcgatcacgctacctcaacgcccaaaga
acaatcaacgagctcctcgacatgggcgtcatccccatcgtcaacgaaaacgacaccctc
gccgtctccgagatcaaattcggtgacaacgacaccctctctgccgtcacagccgccatg
gtccacgccgatttgttgttcctcatgacagacgtcgactgcctctacgacaagaacccc
cggacgaacccagacgcccaaccaatcgaagtagtagaggacatctcctccctcgtagca
gacgtctcaacggccggctcctccctcgggacggggggaatgtccaccaagatcgtcgct
gccagactggccacctcggcgggggtgacaacagtcattaccaaatcatccaacccgggg
aacattgtcaacattgtcaaatacatccagtcctcccggtcccccggctctccgtccaaa
tccggctccgactcggaggagggcgacactccagaaatcatgtcctcctccacctcctcc
ctcaagaaaccagccattcccctccacacccgcttccttccctcccctcacccagtcagg
gatcgctacttctggatcctgcacggtttacgcccccacggcacgttgttcatcgacacg
ggctgctacaaggcccttttgaacaaagccggtcttttacccgtcggagttgtcgacgtg
gaggggactttccaccagcaggaagcggtccggatctgtgtcgtggataagaaacaccct
gggcagcaaccgcaggaggtggggaggtgtctgacgaattattcgagcgcggaggtgagc
aggatcaaggggaagcacacgagtgagattccggggttgttggggtacatggacagcgag
tatgtcgcgcaaagggagagcatcagttttttcagcgggtttcacggcgggggggtgagc
aggccggttacgccggtggggagcggggttaacctggcggggatggtgacgcccaagagg
aggggggcggggacgccggcgcaggaagagaggaggttggaggcggaggataaggagttg
gaggaggaggggttggtcatgagggggaagaaggaggaggggcagcaggttaggtttgtg
gaggaggtcaagattgtgggggaggagggtaagtag

DBGET integrated database retrieval system