KEGG   Podospora anserina: PODANSg5271Help
Entry
PODANSg5271       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pan  Podospora anserina
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pan00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 173 aa AA seqDB search
MKAYIYDDLPGDQRLPHNSGTPISPSELLSLGVLYHHIPSLSDVDALAAERGYKNRDEIT
VSPEAMGDIYETKVRSFFDEHLHEDEEIRYVKDGKGYFDVRDKDERWVRIFLEKNDLIIL
PAGIYHRFTTDDDNYIKALRLFKDEPKWTPLNRTEGLDENAYRKEYVQQFLAA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctacatctacgacgacctccccggcgaccaacgcctcccccacaactcaggc
acccccatctccccctcggagctcctctccctcggcgtcctctaccaccacatcccctcc
ctctccgacgtcgacgccctcgccgccgagcgggggtacaagaaccgcgacgagatcacc
gtctcccccgaggccatgggcgacatctacgagaccaaagtcaggtccttcttcgacgag
cacctccacgaagacgaagagatcaggtacgtcaaggacggcaaggggtactttgacgtc
agggacaaggacgagaggtgggtgaggatcttcctcgagaagaacgatctgatcatcctg
ccggcggggatttaccacaggtttactactgatgatgataattacatcaaggctttgagg
ttgttcaaggacgagcccaagtggacgcctctgaacaggacggaggggttggatgagaac
gcttatcgcaaggagtatgttcagcagttcttggctgcttga

DBGET integrated database retrieval system