KEGG   Podospora anserina: PODANSg5354Help
Entry
PODANSg5354       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pan  Podospora anserina
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PODANSg5354
   00670 One carbon pool by folate
    PODANSg5354
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PODANSg5354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 201 aa AA seqDB search
MRELTLILASTPKMGIGLSGTLPWPSLKKEMAYFARVTKRSPSPNVQNVVIMGRKTWDSI
PAKFRPLPDRLNIVVSRSIGGVEKREDKSLWAGSLEKALQWVGEDGKGKAGRVFVIGGAE
IYKAALGLRETRRVLLTRVEREWECDAVFPLELKEGGEWQRVEQQKMDEWVGEEVPRGRQ
VEKEGTDDETGYEFEMWERVD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagagaactaaccctcatcctagcctccacccccaaaatgggcatcggcctctccggc
accctcccctggccctccctcaagaaagaaatggcctactttgcccgcgtcaccaaacgc
tccccttcccccaatgttcagaacgtcgtcatcatgggacgcaagacatgggactccatc
ccggcaaagttccgccctctgccagacaggttaaatattgttgtcagtcgttccatcggg
ggggttgaaaaacgggaagacaaatcactctgggctggatctctggaaaaggcgctgcag
tgggttggggaggacgggaaggggaaagcggggagggtgtttgttatcggtggggcggag
atctataaagctgcgctcgggttgagagagacgaggcgggttttgttgacgagggtggag
agggagtgggagtgtgatgctgttttcccgttggaactcaaggagggaggggaatggcag
agggtggaacagcaaaaaatggatgagtgggttggggaggaggtgcccaggggacgacag
gtggaaaaggaggggacagacgacgagacggggtatgagtttgagatgtgggagagggtt
gattag

DBGET integrated database retrieval system