KEGG   Podospora anserina: PODANSg5377Help
Entry
PODANSg5377       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pan  Podospora anserina
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PODANSg5377
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PODANSg5377
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PODANSg5377
Protein phosphatases and associated proteins [BR:pan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PODANSg5377
Transcription machinery [BR:pan03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PODANSg5377
Spliceosome [BR:pan03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PODANSg5377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 323 aa AA seqDB search
MADQHEVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKYVHGLGGGSRTSTPRKASK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccaacacgaagtcgaccttgactcgataatcgatcgcctcctggaagtgcgg
ggcagccgaccgggcaagcaagtccagctgctcgaggccgagattcgctatctttgcacc
aaggctcgcgagatcttcatttcgcagcccatccttcttgagcttgaagctcccatcaag
atctgcggtgatattcacgggcaatactatgacttgctccggctgtttgagtacggtgga
ttcccccccgaggccaactacctcttcctcggtgattatgtcgacagaggcaagcagtcc
ctggagaccatctgcctgctgctcgcctacaagatcaagtaccccgagaacttcttcatc
ctccgtggcaaccacgagtgtgcctccatcaaccgtatctatggtttctacgacgagtgc
aagcgtcgctacaacatcaagctctggaagacatttaccgactgcttcaactgtctcccc
attgccgccattattgacgagaagatctttaccatgcacggtggtcttagtcccgacctc
aactctatggagcagatccgccgtgtcatgagacccactgatatccccgactgcggtctg
ctttgcgatctcctgtggtccgacccagataaggacatcaccgggtggagtgagaacgat
cgtggtgtctcgttcacctttggccctgatgtcgtctctcgcttcctgcaaaaacacgac
atggatcttatctgccgtgcccatcaggttgtcgaggatggttacgagttcttctctaag
cgtcagctcgttacgctattcagcgcccccaactactgcggcgagttcgacaatgctggt
gccatgatgagcgtcgacgagagtctcctttgctcattccagattctcaaacccgcagag
aagaaacaaaagtatgttcacggcctcggaggcggaagcagaacctccaccccccggaaa
gcttccaaataa

DBGET integrated database retrieval system