KEGG   Podospora anserina: PODANSg5403Help
Entry
PODANSg5403       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 442 aa AA seqDB search
MRPNLQIKFSKQFPAIGDAEPLDIKEVLSEFLPEVAFQPLKDWKSELAKPRDDWTPPGEL
LTSFTNKAGRFEVWKGTLSDPAVKQLVKRIQILVPLFIEGGTAINVDDKDAGHWTVFFLY
QKKTDPSNKKPTYIFAGYSTVYRFFFLHLPPTPPTTPLSDNTSSPSPINDPIVIKEDFPL
GTPTVDITTLPCRSRISQFLILPPFQHLSLGSRLYHTVYQTYLSHPPTKEITVEDPNEAF
DDMRYINDLRCLRSLPSFQALQINTSTPIPKTGPVPKNIIDEAAAEKVRKEAKITKRQFY
RVLEMQLMSRLGESVRPGIGLDESKKVATATERKEYALWKLMLKKRLYVHNRDALGQLQL
EERVEKLGEVVKGVEFDYARLLVKMEDQEQKLREEGEGVVVVMNGKGKRKSTTEGVDNDD
NGGSVRKKARVEEEEEEEEEEE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccaacctccagatcaagttcagcaagcagttccccgccataggcgacgccgaa
cccctcgacatcaaggaagtcctctccgagttcctccccgaggttgccttccaacccctg
aaagattggaaatccgaacttgccaaaccccgcgacgactggacaccccccggcgagcta
ctcaccagcttcaccaacaaggccggccgctttgaagtctggaaaggcaccctctccgac
ccggccgtcaagcagctcgtcaagcgcatccagatcctcgtccccctcttcatcgagggc
ggcaccgccatcaacgtcgacgacaaagacgccggccactggaccgtcttcttcctctac
caaaagaaaaccgacccctccaacaagaaaccaacctacatcttcgccggctactccacc
gtctaccgcttcttcttcctccacctccccccaaccccaccaaccacccccctttctgac
aacacctcctccccctccccaatcaacgaccccatcgtaatcaaggaagacttccccctc
ggcacccccacagtcgacatcaccaccctcccctgccgctcccgcatctcccagttcctc
atcctcccccccttccagcacctctccctcggctcccgcctctaccacacggtctaccaa
acctacctctcccacccccccacaaaggaaatcaccgtcgaggacccaaacgaggccttt
gacgacatgcgctacatcaacgacctccgctgtttgcgttccctcccctccttccaagcc
ctccagatcaacacctccaccccgatccccaaaacagggcccgtacccaaaaacatcatc
gacgaggccgccgccgaaaaggtacgcaaagaggcaaagattacaaagaggcagttttat
cgcgtcctggaaatgcagctcatgtcccggctgggagagtctgtccgtccgggcatcggc
ctggacgagagcaaaaaagttgccactgcgacggagaggaaggagtacgcgctctggaag
ttgatgctcaagaagaggctgtacgtgcacaatagggacgcgcttggacagctccaacta
gaggagagggtggagaagctgggggaggtggtgaagggggttgagtttgattatgcgagg
ttgcttgtcaagatggaggatcaggagcagaagctgagggaggagggcgagggggtggtg
gtggtgatgaatgggaaggggaagaggaagtcgacgacggagggggttgataatgacgat
aatggggggagtgtgaggaagaaggctagggttgaggaggaggaggaggaggaggaggag
gaggagtag

DBGET integrated database retrieval system