KEGG   Podospora anserina: PODANSg5423Help
Entry
PODANSg5423       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pan  Podospora anserina
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PODANSg5423
   01212 Fatty acid metabolism
    PODANSg5423
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PODANSg5423
   00650 Butanoate metabolism
    PODANSg5423
  Lipid metabolism
   00062 Fatty acid elongation
    PODANSg5423
   00071 Fatty acid degradation
    PODANSg5423
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PODANSg5423
   00310 Lysine degradation
    PODANSg5423
   00380 Tryptophan metabolism
    PODANSg5423
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PODANSg5423
Enzymes [BR:pan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PODANSg5423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 304 aa AA seqDB search
MHPTARLAVRSSGFRAAAGTARLSRFQPSTLPRVVVRFSSSGSNPQYEFIQVTEPRPGVG
QITLNRPKALNALSTPLITELNTALLTFQSTPSIRAILLTGSQKAFAAGADIKEMAPLTF
SSAYLNSFIESWSNLTTTLKKPLIAAVSGHALGGGCELALMADIIYCTKTANFGQPEIKL
GTIPGAGGSQRLTRAVGKAKAMELILTGKSFSGEEAEQWGVAARAFGSYEELMEESLKTA
ETIAGYSKVAVQAAKEVVNKSQELGLRDGVEFERRVFHALFGSEDQKEGMGAFGEKRKAQ
WKDQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccaccgcccgcctcgccgttcgcagcagcggcttccgtgctgctgccggaaca
gctcgtctctcccgcttccagccatccaccctcccccgtgtcgtcgtccgcttttcttcc
tctggatcaaacccccagtatgagttcatccaagtgactgagccccgtccgggcgtcggg
cagatcaccctcaaccgccccaaagccctcaacgccctctccacccccctcataaccgag
ctcaacaccgccctcctcaccttccaatcaaccccctccatccgcgcaatcctcctaacc
gggtcccagaaagccttcgccgccggcgccgacatcaaggaaatggcacccttaaccttc
agctcagcctacctcaactccttcatcgaatcctggtccaacctcaccaccaccctcaaa
aaacccctcatcgccgccgtctccggccacgcacttggcggagggtgtgagttagccctc
atggcggacataatctactgcaccaaaaccgccaatttcgggcagccggaaatcaaactt
ggaaccatccccggagcgggcgggtcgcagaggttgacgagggcggtgggcaaggcaaag
gctatggagctgatattgacggggaagagtttctctggggaggaggcggaacagtggggg
gttgctgcgagggcgtttgggagttatgaggagttgatggaggagagtctcaagactgcg
gagacgattgcggggtacagcaaggttgcggtgcaggcggccaaggaggtggtgaataag
agccaggagttgggattgagggatggggtcgagtttgagagacgggtttttcacgcgttg
tttgggagtgaggatcagaaggaggggatgggggcttttggtgagaagaggaaggctcag
tggaaggatcagtag

DBGET integrated database retrieval system