KEGG   Podospora anserina: PODANSg5429Help
Entry
PODANSg5429       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pan  Podospora anserina
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pan00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PODANSg5429
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PODANSg5429
Protein kinases [BR:pan01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PODANSg5429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 527 aa AA seqDB search
MVASDNQSSEAAAPRPQPPNLTLEFPSPQPSPGSSVPKMNSVPLLRPALPGGNRSGGRAP
RLGLAIPPSPNAKPLSNPGPAPGRPALPTLHLATPMGSSSVVPQEQPQHIKPALSLQSAS
GGSESSAAHSRSGSFGPFDGRASNPTSAGSQFSALSFAEQYGIGPTRHAGTGDPVSAVGS
LYSNASESVGMERENSLHGLESFDKLSLDKARSADVEDLDDEGWRIVSMEKRIVELGSLG
EGAGGAVTRCKLKGGNTVFALKVITTNPDPDVKRQIVRELGFNKDCMSEHICRYYGAFVD
PSTATISIAMEFCEGGSLDSIYKEVKRLGGRTGEKVLGKISEGVLQGLTYLHSKKIIHRD
IKPSNILLCRNGEVKLCDFGVSGEFGTKGDANTFIGTSYYMAPERITGQSYTITSDVWST
GVTLLEVAQHRFPFPADGTEMQPRAGLIDLLTYIVRQPIPKLKDEPEASIFWSDSFKYFI
ECCLEKDPLRRATPWRMLEHPWMVEMKTKRVNMSKYLTQVWGWDDKK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcttcagacaatcagagcagcgaggccgctgcgcctcggcctcagccaccaaac
cttaccctggagttcccatcaccacagccctcgcccggctcctccgtcccaaagatgaac
agcgttcccctcctccgtcccgccctcccaggaggcaaccgctccggcggacgtgctccc
cgtctcggcctcgccatccctccatcccccaacgcaaaaccactcagcaaccccggcccg
gccccaggtagaccagcactcccgactcttcatcttgctacccccatgggaagcagcagc
gtggtcccgcaagaacaaccacaacacatcaagcccgccctcagtctccaatccgccagc
ggcggcagcgaatcgagcgccgcccactccagatccggctctttcggcccctttgacggc
cgtgcgagcaacccaaccagtgcggggtcgcagttcagcgctttgtcgtttgctgagcag
tatggcattggaccgactagacacgccgggacaggggacccggtatcagccgtgggatcg
ctctactcaaacgccagcgagagcgtcggcatggaaagagaaaacagcctacacgggctg
gagagcttcgacaagctgagcctagacaaggcgaggagcgcggatgtggaggatctggac
gatgaaggctggaggatcgtgagcatggagaagaggattgtcgagctggggagtttggga
gagggtgcaggtggtgcggtgacgaggtgtaagctcaagggggggaacacggttttcgct
ctcaaggtcatcacaaccaaccccgaccccgacgtcaaacgccaaatcgtccgcgagctc
ggcttcaacaaggactgcatgtcggagcacatctgcaggtactacggcgcctttgtcgac
ccctcgaccgccaccatctccatcgcgatggaattctgcgagggcggctcgctcgactcc
atctacaaggaagtcaagcgcctcggcggccgcacaggagaaaaagtcctcgggaagatt
tccgagggcgtcctccagggcctgacctacctccacagcaaaaagatcattcaccgtgac
atcaaaccgagcaacatcctcctctgccgcaacggggaggttaagctttgcgactttggt
gtgtcgggtgagtttggcaccaagggagatgccaacacttttatcggaacgagttactac
atggctccggaacggatcacggggcagtcatacaccatcacgagcgacgtctggtcgacg
ggcgtgacgctgctggaggttgcgcagcataggtttccgtttcctgcggacgggaccgag
atgcagcctagggcggggttgattgatttgttgacgtatattgtgaggcagccgattccc
aagctgaaggacgagcccgaggcgagtattttttggagtgatagttttaagtattttatt
gagtgctgtctggagaaggatccgcttaggagggcaacgccgtggaggatgctggagcac
ccttggatggtggagatgaagaccaagagggtgaatatgagcaagtatttgacgcaggtt
tgggggtgggatgataagaagtga

DBGET integrated database retrieval system