KEGG   Podospora anserina: PODANSg5494Help
Entry
PODANSg5494       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
pan  Podospora anserina
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pan01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pan00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 756 aa AA seqDB search
MPAIIDHSPHHPDPSPLVPTASNLILIDNYDSFTWNVYQYLVLEGAKVTVFRNDQITLEE
LIAKKPTQLVISPGPGHPGTDSGISRDAIKHFAGKVPIFGVCMGQQCMIDLYGGEVSFAG
EILHGKTSPLCHDGKGVYAGLAQDLPVTRYHSLAGTHVTLPKCLQVTSWIANQDGSKGVI
MGVRHTEYTIEGVQFHPESILSADGRLMLKNFLYMQGGTWAENEQLQKASQESKIVPKKA
TPAKNNILQKIYAHRKEAVAAQKQIPSQRPSDLQAAYNLNLAPPQISLVDRLRQSPFDVA
LAAEIKRGSPSKGIFALDIDAPTQARRYALAGASVISVLTEPEWFKGSIEDLRAVRQVLN
GMPNRPAVLRKEFIFEEYQILEARLAGADTVLLIVKMLETDLLERLYKYSLSLGMEPLVE
VQNAEEMTIAIKLGAKVIGVNNRNLENFEVDLGTTGRLKEMVPKDTFLLALSGINSHQDV
LDCKRDGINGILVGEAIMRAPDASKFIRELCAGPEAAAPQSVTNPMLVKICGTRSAEAAT
EAIKAGADLVGMILVPGTKRCVSDETALAISKAVHDAQTTAGEAVKLPKSATDFFSVSAE
LLRKHRPLLVGVFMNQPLEEVLEKQRLYNLDIVQLHGDEPLEWASLIPVPVIRKFKPGQV
GVGVRGYHAVSLLDSGAGTGKLLDVESVKAELEKDAELQVLLAGGLEPGNVTESVKALGA
LGGQVIGVDVSSGVEEDGKQSLEKIRAFVKAAKAIR
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccattatcgatcactcaccccaccatcccgatccgtctcccctcgttccgacg
gcgtccaacctaatcctcatcgacaactacgactcctttacctggaatgtctatcagtat
cttgttctggagggcgccaaagtgaccgtcttcagaaacgaccagatcactcttgaagag
ctcattgccaagaagccaacacaactggtcatcagccccggtcccggccatccaggtaca
gactcgggtatcagccgtgatgctatcaaacactttgctggcaaggtgcccatctttggt
gtttgcatggggcagcaatgcatgattgacctgtacggtggagaagtgagctttgctggt
gagattttgcatggcaagacctcacccctttgtcacgatggaaaaggtgtctatgctggc
ctggcccaggacctgccagtaacacgttatcactccctcgccggcactcacgttactctt
ccaaaatgcctccaggtcacctcctggatcgccaatcaagatgggtccaagggtgtcatc
atgggtgttcgccacacagagtacactatcgagggtgtgcaattccacccagaaagtatc
ctgtctgccgatggccgcctcatgctcaagaactttttgtacatgcaggggggcacttgg
gctgagaatgagcagttgcaaaaggcttcccaagagtccaagattgtcccgaaaaaggcc
actccagccaagaacaacatccttcaaaagatctacgctcaccgtaaggaggccgtggcc
gcccagaagcagattccctcacaaagaccatccgacttgcaagcggcgtacaacctcaac
ctcgcccctcctcagatctccctcgtcgaccgtcttcgtcagtccccattcgatgtagct
ttggcggcagagattaagagagggtcaccatccaagggcatctttgctctcgatatcgac
gccccaacccaggcccgcagatacgctcttgccggagccagtgtcatttccgttctcacc
gagccagagtggttcaagggcagcattgaagacctccgcgctgtgcgccaagtactcaat
ggcatgcccaaccgcccggctgttctccgaaaggagttcatttttgaggagtaccagatt
ttggaagcccggctggcaggtgccgatactgtgcttctcattgtcaagatgttggagacc
gaccttctcgagcgtctgtacaagtactcgctctcactcggcatggaaccattagtagag
gtacaaaacgccgaagagatgaccattgccatcaagcttggtgccaaggtcattggtgtc
aacaaccgcaacctggagaatttcgaggtcgatcttggaaccacggggcgcttgaaggaa
atggtgcccaaggacacattcttgctcgctctcagcggcatcaacagccaccaggatgtt
ctcgattgcaagagggatggtatcaacggcattcttgttggcgaggccatcatgcgcgct
cccgacgcgtccaagtttatcagggagctttgtgctggtcctgaggcggctgctcctcag
agtgttaccaaccctatgcttgtcaaaatctgcggcacccgctctgccgaggcggccacg
gaagctatcaaggctggtgctgaccttgtgggcatgattcttgtgcctggcacgaaacgg
tgtgtttctgatgaaacggccctggccatctcgaaggctgttcatgatgcgcagaccact
gctggtgaggcggttaaactccccaagtcagccacggacttcttttctgtttcggctgag
ctcctgaggaaacaccgccctcttcttgtaggtgtgtttatgaaccagcccctggaggaa
gtgctcgagaagcagaggctgtacaaccttgatatcgtccaacttcacggtgacgagcca
cttgagtgggcgtcccttatcccggtaccagtcatccggaagttcaagcctgggcaggtt
ggcgttggagtgagggggtaccacgctgtttcactcctggattctggcgctggcacaggc
aagttgcttgatgttgagagtgtcaaggccgagttggagaaggatgctgagttgcaggtg
ttgttggctggtggtctggagccagggaacgtgaccgagtctgtgaaggccttgggtgcg
ttgggcgggcaggttattggtgttgatgttagcagtggggtagaggaggatgggaagcag
agcttggaaaagattagggcttttgtcaaggctgcgaaggctattcggtag

DBGET integrated database retrieval system