KEGG   Podospora anserina: PODANSg5494Help
Entry
PODANSg5494       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
pan  Podospora anserina
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PODANSg5494
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PODANSg5494
Enzymes [BR:pan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PODANSg5494
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     PODANSg5494
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PODANSg5494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 756 aa AA seqDB search
MPAIIDHSPHHPDPSPLVPTASNLILIDNYDSFTWNVYQYLVLEGAKVTVFRNDQITLEE
LIAKKPTQLVISPGPGHPGTDSGISRDAIKHFAGKVPIFGVCMGQQCMIDLYGGEVSFAG
EILHGKTSPLCHDGKGVYAGLAQDLPVTRYHSLAGTHVTLPKCLQVTSWIANQDGSKGVI
MGVRHTEYTIEGVQFHPESILSADGRLMLKNFLYMQGGTWAENEQLQKASQESKIVPKKA
TPAKNNILQKIYAHRKEAVAAQKQIPSQRPSDLQAAYNLNLAPPQISLVDRLRQSPFDVA
LAAEIKRGSPSKGIFALDIDAPTQARRYALAGASVISVLTEPEWFKGSIEDLRAVRQVLN
GMPNRPAVLRKEFIFEEYQILEARLAGADTVLLIVKMLETDLLERLYKYSLSLGMEPLVE
VQNAEEMTIAIKLGAKVIGVNNRNLENFEVDLGTTGRLKEMVPKDTFLLALSGINSHQDV
LDCKRDGINGILVGEAIMRAPDASKFIRELCAGPEAAAPQSVTNPMLVKICGTRSAEAAT
EAIKAGADLVGMILVPGTKRCVSDETALAISKAVHDAQTTAGEAVKLPKSATDFFSVSAE
LLRKHRPLLVGVFMNQPLEEVLEKQRLYNLDIVQLHGDEPLEWASLIPVPVIRKFKPGQV
GVGVRGYHAVSLLDSGAGTGKLLDVESVKAELEKDAELQVLLAGGLEPGNVTESVKALGA
LGGQVIGVDVSSGVEEDGKQSLEKIRAFVKAAKAIR
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccattatcgatcactcaccccaccatcccgatccgtctcccctcgttccgacg
gcgtccaacctaatcctcatcgacaactacgactcctttacctggaatgtctatcagtat
cttgttctggagggcgccaaagtgaccgtcttcagaaacgaccagatcactcttgaagag
ctcattgccaagaagccaacacaactggtcatcagccccggtcccggccatccaggtaca
gactcgggtatcagccgtgatgctatcaaacactttgctggcaaggtgcccatctttggt
gtttgcatggggcagcaatgcatgattgacctgtacggtggagaagtgagctttgctggt
gagattttgcatggcaagacctcacccctttgtcacgatggaaaaggtgtctatgctggc
ctggcccaggacctgccagtaacacgttatcactccctcgccggcactcacgttactctt
ccaaaatgcctccaggtcacctcctggatcgccaatcaagatgggtccaagggtgtcatc
atgggtgttcgccacacagagtacactatcgagggtgtgcaattccacccagaaagtatc
ctgtctgccgatggccgcctcatgctcaagaactttttgtacatgcaggggggcacttgg
gctgagaatgagcagttgcaaaaggcttcccaagagtccaagattgtcccgaaaaaggcc
actccagccaagaacaacatccttcaaaagatctacgctcaccgtaaggaggccgtggcc
gcccagaagcagattccctcacaaagaccatccgacttgcaagcggcgtacaacctcaac
ctcgcccctcctcagatctccctcgtcgaccgtcttcgtcagtccccattcgatgtagct
ttggcggcagagattaagagagggtcaccatccaagggcatctttgctctcgatatcgac
gccccaacccaggcccgcagatacgctcttgccggagccagtgtcatttccgttctcacc
gagccagagtggttcaagggcagcattgaagacctccgcgctgtgcgccaagtactcaat
ggcatgcccaaccgcccggctgttctccgaaaggagttcatttttgaggagtaccagatt
ttggaagcccggctggcaggtgccgatactgtgcttctcattgtcaagatgttggagacc
gaccttctcgagcgtctgtacaagtactcgctctcactcggcatggaaccattagtagag
gtacaaaacgccgaagagatgaccattgccatcaagcttggtgccaaggtcattggtgtc
aacaaccgcaacctggagaatttcgaggtcgatcttggaaccacggggcgcttgaaggaa
atggtgcccaaggacacattcttgctcgctctcagcggcatcaacagccaccaggatgtt
ctcgattgcaagagggatggtatcaacggcattcttgttggcgaggccatcatgcgcgct
cccgacgcgtccaagtttatcagggagctttgtgctggtcctgaggcggctgctcctcag
agtgttaccaaccctatgcttgtcaaaatctgcggcacccgctctgccgaggcggccacg
gaagctatcaaggctggtgctgaccttgtgggcatgattcttgtgcctggcacgaaacgg
tgtgtttctgatgaaacggccctggccatctcgaaggctgttcatgatgcgcagaccact
gctggtgaggcggttaaactccccaagtcagccacggacttcttttctgtttcggctgag
ctcctgaggaaacaccgccctcttcttgtaggtgtgtttatgaaccagcccctggaggaa
gtgctcgagaagcagaggctgtacaaccttgatatcgtccaacttcacggtgacgagcca
cttgagtgggcgtcccttatcccggtaccagtcatccggaagttcaagcctgggcaggtt
ggcgttggagtgagggggtaccacgctgtttcactcctggattctggcgctggcacaggc
aagttgcttgatgttgagagtgtcaaggccgagttggagaaggatgctgagttgcaggtg
ttgttggctggtggtctggagccagggaacgtgaccgagtctgtgaaggccttgggtgcg
ttgggcgggcaggttattggtgttgatgttagcagtggggtagaggaggatgggaagcag
agcttggaaaagattagggcttttgtcaaggctgcgaaggctattcggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system