KEGG   Podospora anserina: PODANSg5502Help
Entry
PODANSg5502       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PODANSg5502
Protein kinases [BR:pan01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PODANSg5502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 908 aa AA seqDB search
MEQWQSYTEPTSAGGSRRYNGSSQMSPREYSSNGQPAAQPPAGFKYDQYQGGLNPQQQQQ
QQQQQQVQQASSSSSPMTSPQIRDGNGDVAMQDAHDGYSGVNSSVKYPLRPHHSHHLSGG
RAANLQQEPSTAAQRYSPMEVLSPTSPYKSTGGSQYAQPQQRQSPTRSSDYAPQNPYYNS
SRQTASQLPPLNPYSSIPDNYSPSNNISAMDGSYMDPKSPKRAPQQAMQLHDKGPVPEFR
KIRGPSDLKPKISAQPPFRRANPEGGFISPLQALTAHLPATYQICNPSFKYSSARNPRRV
LTKPSKGVKNDGFDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVVKCQNLK
TQEVVAVKVIKNRTAYFNQSMMEVSVLDLLNTKLDKNDDHHLLRLKDTFIHRQHLCLVFE
LLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLTLLNKARLIHCDLKPENILLKNLESP
IIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLGLPLF
PGSSEYNQVSRIVEMLGNPPNWMIEVGKQAGDFFEKRQDDFGRRTYHLKSMEQYSREHNT
KEQPSKKYFQANTLPEIIKSYPMPRKNMKQSEIDREMNNRIAFIDFVRGLLTINPLERWS
PQQAKLHPFITQQKYTGQFVPPMNLKSSALNRSPAPGTTQQIQAEALSKQRAQQAQAQAQ
ASSAAQGAYGSMGAPQYQQPVHPQQPPLYTNNTMYSPSGSHTGAPPAYASQPSGYGQMGV
QQPPAQMPPANYAAGGIPQVNMYSQQNRQQQQPRPRASTMEQQQSGIPAAIQRVASHLDP
SQPIRLQPSPAYYPPPPDGLVGMDQGGPSTRTGRRGSRAQQPGRNFIRNLEERTLEEGFM
GNNQSPWH
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtggcagtcatacaccgagccgaccagcgctggcggttcacgacgatacaac
ggctccagccagatgtcgcccagagagtactccagcaatggacagcccgcggcgcaacct
ccagccggcttcaagtatgaccagtaccaaggcggcttaaacccgcaacaacaacaacaa
cagcagcagcagcagcaggtgcagcaggcatcttcatcgtcttcgcccatgaccagtccc
cagattcgcgacggcaacggagacgtcgccatgcaggatgcccatgatggctactccggc
gtcaattccagcgtcaagtatcccctgcgcccccatcattcccaccacctctctggtgga
cgagccgcgaacttgcagcaagagccctcgaccgctgcgcaacgatactcacccatggaa
gtcttgtctcctacatcaccatacaagtcaactggaggtagccagtatgcgcagccccag
caacgacagtcgccgacccgatcgtcggactatgccccgcagaacccgtactataacagt
agtcgccaaaccgcctcccagctacctcctttaaacccctactcctccattccagacaac
tactcgccgtcgaataacatctcggccatggacggttcttacatggatcccaagtctccc
aagcgtgccccccaacaagccatgcaattgcacgacaagggcccggtgcccgagttcagg
aagattcgaggcccatctgacctgaagcccaagatcagcgcgcagccgccgttccggaga
gccaaccctgagggaggcttcatcagtcctctccaagctctcacggcgcaccttccagcc
acgtaccagatttgcaatcccagtttcaagtactcttcggcacggaatccccgtcgtgtc
ctgacgaaaccgagcaagggtgtgaagaacgatgggtttgataacgaggatagtgactat
atcctctatgtcaacgatatcctgggctctgaggaagccgggcacaagaaccgttacttg
attttggatgttcttggccaaggtactttcggccaggttgtcaagtgccaaaacctcaag
acccaagaggtcgtggctgtcaaggtgatcaagaaccggaccgcctacttcaaccaaagt
atgatggaggtgtctgtgcttgacttgctcaacaccaagctcgacaagaacgacgatcat
catctgctccggctcaaggatacattcattcacaggcagcatctgtgcttggtcttcgag
ctgttgagcgtcaacttgtacgagctcatcaaacagaaccagttccgcgggttgagcacg
acgctggtccgagtctttgcccagcagctgcttaacgggcttacgctgctcaacaaggcg
cggctgattcattgcgatctcaaacccgaaaacatcctgctgaaaaacctcgagagcccg
attatcaagattattgactttggctccgcctgcgacgagcgtcaaactgtgtacacgtac
atccagtcgcgtttctaccgatcacccgaagttctactaggcttaccatattcgtcagca
atcgatatgtggtcgctggggtgcatcgtggtcgagctgttcctgggtctacccttgttc
ccaggatcctccgagtacaaccaggtttcgcgaatcgttgagatgcttggcaatccacca
aactggatgatcgaggtgggcaaacaagctggtgatttcttcgagaagagacaggatgat
tttggcaggcggacatatcacctgaagagcatggagcagtattcccgggagcacaacacc
aaggagcagcccagcaagaagtatttccaggcgaacacgctgcctgagatcatcaagtcg
tatccaatgccccggaagaacatgaagcagtcggagattgatagagagatgaataaccgc
atcgcgttcatcgactttgtcaggggcctcttgacgatcaacccactcgagagatggtcg
ccacagcaagcgaaactgcaccctttcatcacccaacaaaagtataccggccagtttgtg
ccgccaatgaacctcaagtctagcgccctgaacagatcgcctgccccaggcacgacgcag
cagattcaggccgaagctctgagcaagcagagggcacagcaagcgcaggctcaggctcag
gccagctcggcggcgcagggagcatacgggtctatgggtgcaccgcagtatcaacaacca
gtgcatccacagcaaccacctttgtacaccaacaacaccatgtattctcctagcgggtca
cataccggcgcgccacctgcatatgccagccaaccgagcgggtacggccaaatgggcgta
caacaaccgcctgcccaaatgccgccagcaaactatgctgccggcggtattccacaggtc
aatatgtattcgcagcaaaaccgtcagcaacaacaacccagaccgcgtgcctcgaccatg
gagcagcaacaaagcggtattcccgctgccattcaaagggtggccagccacctcgaccca
agccagccgattcgattacagccaagtcctgcttattatccaccacctcctgatggcttg
gtgggcatggaccagggcgggccatcgaccaggacaggtagaaggggcagccgcgcccag
cagccaggacgcaacttcatccgcaacctggaggagcgaacactcgaggaagggttcatg
gggaataaccagagcccctggcactga

DBGET integrated database retrieval system