KEGG   Podospora anserina: PODANSg5539Help
Entry
PODANSg5539       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pan  Podospora anserina
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PODANSg5539
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    PODANSg5539
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     PODANSg5539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 296 aa AA seqDB search
MARLAAARYGKDNVRVYKVHKDEATGTQSVTEMTVCCLLEGQIETSYTEADNSVVVATDS
IKNTIYIKAKEHPVNPPELYAAHLGQHFLDKYPHINAANIKVIVHRWTRINIDGKPHPHS
FYRDGNETRNVEARVSREAGIELKSAIQGLSVLKSTGSAFHGFVRDEYTTLGETWDRILS
TDVDATWNWKTFATVADVEKGVERFDQAFEAARNITLKTFAEDESASVQNTMYKMCEEIL
EKAAEVEVVGYSLPNKHYFEIDLSWHKGYKNTGKDAEVYAPQSGPNGLIKCEVTRS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcttgctgctgctcgctatggaaaggacaatgtccgtgtctacaaggtgcac
aaggatgaggctaccggcactcagtccgtcactgagatgaccgtctgctgccttctcgag
ggccagattgagacttcttacaccgaggccgacaacagcgttgttgtggctaccgattct
atcaagaacaccatttacatcaaggccaaggagcaccccgtcaacccccctgagctttac
gccgcccacctcggccagcacttcctcgacaagtacccccacatcaacgccgccaacatc
aaggtgatcgttcacagatggactcgcatcaacatcgacggcaaaccccacccccacagc
ttctaccgcgacggcaacgagacccgcaacgtggaagctcgcgtctcccgcgaggctggc
attgagctcaagtccgccatccagggtctctccgtccttaagtccaccggctctgccttc
cacggcttcgtccgggacgagtacaccaccctcggcgagacttgggaccgtatcctgtct
accgacgttgatgccacctggaactggaagacctttgccaccgtcgccgacgtggagaag
ggcgttgagaggttcgaccaggctttcgaggcggcccgcaacatcaccctcaagacgttc
gccgaggacgagtccgcctcggtccagaacaccatgtacaagatgtgcgaggagatcttg
gagaaggcggccgaggtggaggttgttggctactctttgcccaacaagcactactttgag
attgacctcagctggcacaagggctacaagaacaccggcaaggacgccgaggtgtacgct
ccccagtctggccccaatggcctcatcaagtgcgaggtcactcgctcctaa

DBGET integrated database retrieval system